SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126598 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126598
Domain Number 1 Region: 371-559
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.9e-65
Family Regulator of G-protein signaling, RGS 0.00000781
Further Details:      
 
Domain Number 2 Region: 768-997
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.15e-64
Family DBL homology domain (DH-domain) 0.000000000949
Further Details:      
 
Domain Number 3 Region: 1001-1131
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-38
Family Pleckstrin-homology domain (PH domain) 0.00000127
Further Details:      
 
Domain Number 4 Region: 69-149
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-22
Family PDZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126598   Gene: ENSMUSG00000059495   Transcript: ENSMUST00000165665
Sequence length 1544
Comment pep:known chromosome:NCBIM37:9:42771925:42913801:-1 gene:ENSMUSG00000059495 transcript:ENSMUST00000165665
Sequence
MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERSSSHDFDPTDSSSKKTKSSSEE
SRSEIYGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGT
LVTHSNHLEVVKLIRSGSYVALTVQGRPPGSPQIPLADSEVEPSVTGHMSPIMTSPHSPG
AAGNMERITSPVLVGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTATQRLLKEIQ
EAKKHIPQLQEQLSKATGSAQDGAVIAPSRPLGDALTLSEAEADPGDGLCRTDWSSGDAS
RPSSDSADSPKSSLRERSYLEEAPERSEGVQDAQEPQSLVGSPSTRGAPHIIGAEDDDFG
TEHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKQTNSKETR
RVFLEFHQFFLDRSAHLKVPVPEEISVDLEKRRPELIPEDLHRLYIQTMQERVHPEVQRH
LEDFRQKRSMGLTLAESELTKLDAERDKDRGTLEKERACAEQIVTKIEEVLMTAQAVEEE
RSSTMQYVILMYMKYLGVKVKEPRNLEHKRGRIGFLPKIKQSMKKDREGEEKGKRRGFPS
ILGPPRRPSRHDNSAIGRAMEIQKSRHPKHLSTPSSVSPEPQDPAKLRQSGVANEGTDTG
YLPASSMSSATSGTALSQEGGRENDTGTKQVGEASAPGDCLDSTPRVPTTVFDFPPPLLD
QVQEEECEVERVAEHGTPKPFRKFDSIAFGESQSEDEQFENDLETDPPNWQQLVSREVLL
GLKPSEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDIL
QLHVGLNEQMKAVRKRNETSVIDHIGEDLLIWFSGPGEEKLKHAAATFCSNQPFALEMIK
SRQKKDSRFHTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPPEREK
VKKAADHCRQILNYVNQAVREAENKQRLEDYQRRLDTSNLKLSEYPNVDELRNLDLTKRK
MIHEGPLVWKVNRDKSIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPV
IKLSTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQST
KPIPLPQPPPCEGDNDEEEPAKLKVEHHDLSVAGLQSPDRVLGLESPLISSKPQSHSLNT
PGKSAAEHLFVTATQFAKEQHANGALKEGDGGYPVTIPGPHLPVSEERWALDALRNLGLL
KQLLVQQLGLTEKSTQEDWQSFSRYGPASEEVQADSGIRDLENVKACHAREGQMSFKTGT
GDIATCDSPRTSTESCAAQDSVILASQDSQASNVLVMDHMILTPEMPPAEPEGGLDESGE
HFFDAREAHSDDNPSEGDGAVKKEEKDVNLRISGNCLILDGYDAVQESSTDEEVASSFPL
QPVTGIPAVDSSHQQQHSPQNVHPEGPVSPFTPEFLVQRHWRAMEDTCFEIQSPSCTDSQ
SQILEYIHKIEADLEHLKKVEESYALLCQRLAGSALPDKLSDKS
Download sequence
Identical sequences F8VQN6
10090.ENSMUSP00000072547 ENSMUSP00000126598 ENSMUSP00000126598 ENSMUSP00000072547 NP_081420.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]