SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126696 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126696
Domain Number 1 Region: 364-631
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-72
Family Protein kinases, catalytic subunit 0.00000000185
Further Details:      
 
Domain Number 2 Region: 56-131
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.91e-26
Family Ras-binding domain, RBD 0.000013
Further Details:      
 
Domain Number 3 Region: 131-184
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000129
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126696   Gene: ENSMUSG00000000441   Transcript: ENSMUST00000167308
Sequence length 668
Comment pep:known chromosome:NCBIM37:6:115568591:115626653:-1 gene:ENSMUSG00000000441 transcript:ENSMUST00000167308
Sequence
MEHIQGAWKTISNGFGLKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLQEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTVGDSGVPAPPSFPMRRMRESVSRMPASSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLHVDSRMIESNSLNASPRACSRRFCLRGRDA
IRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSY
YWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQLQAFRNEVAVLRKT
RHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLH
AKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQ
DDNPFSFQSDVYSYGIVLYELMAGELPYAHINNRDQIIFMVGRGYASPDLSRLYKNCPKA
MKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLT
TSPRLPVF
Download sequence
Identical sequences XP_006505426.1.92730 XP_006505427.1.92730 ENSMUSP00000126696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]