SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126942 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126942
Domain Number 1 Region: 4-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 9.23e-19
Family SAM (sterile alpha motif) domain 0.0000631
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126942   Gene: ENSMUSG00000079226   Transcript: ENSMUST00000111433
Sequence length 190
Comment pep:known chromosome:NCBIM37:19:11165998:11166567:-1 gene:ENSMUSG00000079226 transcript:ENSMUST00000111433
Sequence
MSSVSEVNADIRDFLMSINLEQYLLHFREFGFYTVRDCTSINDSVLHQIGISPTGHRRRI
LKQLQMIFSKMQDFPIYANVHKAKNGSTTKEQQHSDPSSSSHTGIECSDSVTVHRPGPAP
SEMVTTSTLSEGNCQSPKSHDKLCLSSHDLPCPEEELHQNVDSSKDSLFGGVNVKIDPLI
TKRAVEYTAG
Download sequence
Identical sequences ENSMUSP00000126942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]