SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000127334 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000127334
Domain Number 1 Region: 348-481
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.000000000000955
Family Mannose 6-phosphate receptor domain 0.0092
Further Details:      
 
Domain Number 2 Region: 196-258
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.000000000275
Family Mannose 6-phosphate receptor domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000127334   Gene: ENSMUSG00000020311   Transcript: ENSMUST00000170746
Sequence length 497
Comment pep:known chromosome:NCBIM37:11:30829784:30854122:-1 gene:ENSMUSG00000020311 transcript:ENSMUST00000170746
Sequence
FSSGRGGCDGGWRTRQWRKETAACGVPGGPLLLVLYGLLEASGGGRALPQLSDDIPFRVN
WPGTEFSLPTTGVLYKEDNYIIMTTAHKEKYKCILPLVTSGDEEEEKDYKGPNPRELLEP
LFKQSSCSYRIESYWTYEVCHGKHIRQYHEEKETGQKVNIHEYYLGNMLAKNLLYEKERE
AKENEKSNEIPTKNIEGQMTPYYPVGMGNGTPCSLKQNRPRSSTVMYICHPESKHEILSV
AEVTTCEYEVVILTPLLCSHPKYKFRASPVNDIFCQSLPGSPFKPLTLRQLEQQEEILRV
PFRRNKEEDLPSAKEERFPAIHKPIAVGSQPVLTVGTTHISKLTDDQLIKEFLSGSYCFH
GGVGWWKYEFCYGKHVHQYHEDKDNGKTSVVVGTWNQEEHVEWAKKNTARAYHLQDDGTQ
TVRMVSHFYGNGDICDITDKPRQVTVKLKCKESDSPHAVTVYMLEPHSCQYILGVESPVI
CKILDTADENGLLSLPN
Download sequence
Identical sequences ENSMUSP00000127334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]