SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000127370 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000127370
Domain Number 1 Region: 133-414
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.53e-111
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000234
Further Details:      
 
Domain Number 2 Region: 417-709
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.44e-99
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000127370   Gene: ENSMUSG00000041836   Transcript: ENSMUST00000169654
Sequence length 719
Comment pep:known chromosome:NCBIM37:7:142729522:142875197:1 gene:ENSMUSG00000041836 transcript:ENSMUST00000169654
Sequence
MRSRRGGAIGATAPVPGRCTMEPFCPLLLASFSLSLARAGQGNDTTPTESNWTSTTAGPP
DPGASQPLLTWLLLPLLLLLFLLAAYFFRFRKQRKAVVSSNDKKMPNGILEEQEQQRVML
LSRSPSGPKKFFPIPVEHLEEEIRVRSADDCKRFREEFNSLPSGHIQGTFELANKEENRE
KNRYPNILPNDHCRVILSQVDGIPCSDYINASYIDGYKEKNKFIAAQGPKQETVNDFWRM
VWEQRSATIVMLTNLKERKEEKCYQYWPDQGCWTYGNIRVCVEDCVVLVDYTIRKFCIHP
QLPDSCKAPRLVSQLHFTSWPDFGVPFTPIGMLKFLKKVKTLNPSHAGPIVVHCSAGVGR
TGTFIVIDAMMDMIHSEQKVDVFEFVSRIRNQRPQMVQTDVQYTFIYQALLEYYLYGDTE
LDVSSLERHLQTLHSTATHFDKIGLEEEFRKLTNVRIMKENMRTGNLPANMKKARVIQII
PYDFNRVILSMKRGQEFTDYINASFIDGYRQKDYFMATQGPLAHTVEDFWRMVWEWKSHT
IVMLTEVQEREQDKCYQYWPTEGSVTHGDITIEIKSDTLSEAISVRDFLVTFKQPLARQE
EQVRMVRQFHFHGWPEVGIPAEGKGMIDLIAAVQKQQQQTGNHPITVHCSAGAGRTGTFI
ALSNILERVKAEGLLDVFQAVKSLRLQRPHMVQTLEQYEFCYKVVQDFIDIFSDYANFK
Download sequence
Identical sequences A0A1B0GRT6
NP_001303607.1.92730 ENSMUSP00000127370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]