SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000128167 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000128167
Domain Number 1 Region: 278-418
Classification Level Classification E-value
Superfamily PH domain-like 4.67e-44
Family Third domain of FERM 0.000000176
Further Details:      
 
Domain Number 2 Region: 168-277
Classification Level Classification E-value
Superfamily Second domain of FERM 1.16e-39
Family Second domain of FERM 0.000000579
Further Details:      
 
Domain Number 3 Region: 575-662
Classification Level Classification E-value
Superfamily Moesin tail domain 4.71e-33
Family Moesin tail domain 0.0000211
Further Details:      
 
Domain Number 4 Region: 81-166
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.45e-26
Family First domain of FERM 0.00000682
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000128167
Domain Number - Region: 513-556
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.0144
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000128167   Gene: ENSMUSG00000032050   Transcript: ENSMUST00000172248
Sequence length 662
Comment pep:known chromosome:NCBIM37:9:51856046:51896842:1 gene:ENSMUSG00000032050 transcript:ENSMUST00000172248
Sequence
RRRAAILPSCLRRLRRVFSQAAQGSHRRLSARSPPATTPPPSRASASRRRAGKEPLIFGA
IIVYRSEEFLKKVTNKKKKMPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLRE
VWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRL
FFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQH
KLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVD
ALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRIL
ALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIE
REKEELMERLRQIEEQTVKAQKELEEQTRKALELEQERQRAKEEAERLDRERRAAEEAKS
AIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKE
ELKTVMSAPPPPPPPPVIPPTENEHDEQDENSAEASAELSSEGVMNHRSEEERVTETQKN
ERVKKQLQALSSELAQARDETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFE
AM
Download sequence
Identical sequences Q3U111
ENSMUSP00000128167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]