SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000128914 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000128914
Domain Number 1 Region: 142-229
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.000000000131
Family Mannose 6-phosphate receptor domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000128914   Gene: ENSMUSG00000040462   Transcript: ENSMUST00000164259
Sequence length 672
Comment pep:known chromosome:NCBIM37:10:126531315:126558216:-1 gene:ENSMUSG00000040462 transcript:ENSMUST00000164259
Sequence
MAAEVLLSSLLGLLFLGLLLPARLTGGVGSLNLEELSEMRYGIQILPLPVMGGQSQASDV
VVVSSKYKQRYECRLPAGAIHFQREREEETPAYQGPGIPELLSPMRDAPCLLKTKDWWTY
EFCYGRHIQQYHMEDSEIKGDVLYLGHYQSSFNWDDETAKASKQHRLKRYHSQTYGNGSK
CDLNGKPREAEVRFLCDEGAGISGDYIDRVDEPVSCSYVLTIRTSRLCPHPLLRPPASAA
PQAILCHPALQPDEYMAYLQRQAESKQHEEKTTEEVQDTDRQVWSGSKAAGAPPKKEDVS
PAKEEKESELWKLQGPEEQAAAREEAQAGEQDLNHEAAADPAPSPPNDFQNNVQVKLIRS
PADLIRLIEELKAAEKGKPSVRREQPGDDTTEAPQREAEGTKAKGKDGEPPGLMEEEDGD
DEEEEEEEEEDEEEQQLLGEFEKELEGMLLPSNRERLRSEVKAGMERELENIIQETEKEL
DPEGLRKESEREQAILALTSTLDKLIKRLQENQSPELVQKYKKRRVVPQKPPPSPHPTEE
EPEHRVRVRVTKLRPGGPNRDLTVLEMNRENPQLKQIEGLVTEVLEREGLTAEGKIEIKI
VRPGAEGKEEDTRWLTDEDTRNLKEIFFNILVQGAEEANKERQRQSELESNYRRVWGSPG
GEDTGDLDEFDF
Download sequence
Identical sequences Q8K2C7
ENSMUSP00000128914 ENSMUSP00000128914 ENSMUSP00000128914 NP_001164497.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]