SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000129255 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000129255
Domain Number 1 Region: 317-443
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.26e-27
Family SPRY domain 0.00072
Further Details:      
 
Domain Number 2 Region: 10-62
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000331
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 86-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000168
Family B-box zinc-binding domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000129255   Gene: ENSMUSG00000067399   Transcript: ENSMUST00000163255
Sequence length 446
Comment pep:known chromosome:NCBIM37:9:88475729:88483945:1 gene:ENSMUSG00000067399 transcript:ENSMUST00000163255
Sequence
MESDNLQDPQEETLTCSICQSIFMNPVYLRCGHKFCEACLLLSQEDIKFPAYCPMCMQPF
NQEYINDISLKKQVSIVRKKRLMKYLNSKEHKCVTHKAKKMIFCDKSKILLCHLCSDSQE
HSGHTHCSIDVAVQEKMEELLKHMDSLWRRLKIQQNYVEIERRTTLWWLKSVKLREEVIK
RVYGKQCPPLCEERDQHIECLRHQSNTTLEELRKSEATIVHERNQLIEVYRELMTMSQRP
YQELLVQDLDDLFRRSKLAAKLDMPQGMIPRLHAHSIPGLTARLNSFRVKISFKHSIMFG
YTSVRPFDIRLLHESTSLDSAETHRVSWGKKSFSRGKYYWEVDLKDHEQWTVGVRKDPWL
RGRSYAATPTDLFLLECLRKEDHYILITRIGGEHYIEKPVGQVGVFLDCEGGYVSFVDVA
KSSLILSYSPGTFHCAVRPFFSAVYT
Download sequence
Identical sequences ENSMUSP00000129255 XP_017168975.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]