SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000129491 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000129491
Domain Number 1 Region: 99-284
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-56
Family Phosphotyrosine-binding domain (PTB) 0.000000182
Further Details:      
 
Domain Number 2 Region: 452-562
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-28
Family SH2 domain 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000129491   Gene: ENSMUSG00000020312   Transcript: ENSMUST00000163867
Sequence length 573
Comment pep:known chromosome:NCBIM37:10:79080685:79100663:-1 gene:ENSMUSG00000020312 transcript:ENSMUST00000163867
Sequence
MTQGPGGRAAPEPEAPTTFCALLPRMPQWKFAAPGSFLGRGPAATRVAGVAEAQPEPGVP
ALAAVLGACEPRCAAPCPLPALGRCRGSGTRGARVTPDVADEWVRKGGFIHKPAHGWLHP
DARVLGPGVSYIVRYMGCIEVLRSMRSLDFNTRTQVTREAINRLHEAVPGVRGSWKKKAP
NKALASILGKSNLRFAGMSISVNISVDGLNLSVPATRQIIANHHMQSISFASGGDTDMTD
YVAYVAKDPINQRACHILECCEGLAQSVISTVGQAFELRFKQYLHSPPKAVVPPERLTGL
EELAWGDDDAAADHNYYNSIPGKEPPLGGLVDSRLAVTQPCALATLGGLGQGMTPVWRDA
RGLPWDMGPSGAAPPGDGYVQADARGPHDYEEHLYVNTQGLDAVELEDTAEAPLQFEDSP
KKDLFDMRPFEDALKLHACSVAAGITAASPPLEDQWPSPPTRRAPIAPTEEQLRQEPWYH
GRMSRRAAEKLLRADGDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVDPEGVVRTKDVLFE
SISHLIDYHLKNGLPIVAAESELHLRGVVSREP
Download sequence
Identical sequences E9QLZ0 Q8BMC3
ENSMUSP00000020564 NP_001019710.1.92730 ENSMUSP00000129491 ENSMUSP00000129491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]