SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000129735 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000129735
Domain Number 1 Region: 201-348
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.67e-42
Family Dual specificity phosphatase-like 0.000000204
Further Details:      
 
Domain Number 2 Region: 3-149
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.3e-31
Family Cell cycle control phosphatase, catalytic domain 0.000000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000129735   Gene: ENSMUSG00000019960   Transcript: ENSMUST00000155150
Sequence length 387
Comment pep:known chromosome:NCBIM37:10:98725865:98730122:1 gene:ENSMUSG00000019960 transcript:ENSMUST00000155150
Sequence
MIDTLRPVPFASEMAICKTVSWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPG
IMLRRLQKGNLPVRALFTRCEDRDRFTRRCGTDTVVLYDENSSDWNENTGGESVLGLLLK
KLKDEGCRAFYLEGGFSKFQAEFALHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDI
ESDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVT
PNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRS
VTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPTP
QLYFHALQPERLPGGLPAVYVKGTHLS
Download sequence
Identical sequences ENSMUSP00000129735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]