SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000130116 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000130116
Domain Number 1 Region: 355-500
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.77e-22
Family Regulator of G-protein signaling, RGS 0.0033
Further Details:      
 
Domain Number 2 Region: 575-709
Classification Level Classification E-value
Superfamily PX domain 1.44e-21
Family PX domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000130116   Gene: ENSMUSG00000032422   Transcript: ENSMUST00000165315
Sequence length 964
Comment pep:known chromosome:NCBIM37:9:88271585:88333789:-1 gene:ENSMUSG00000032422 transcript:ENSMUST00000165315
Sequence
MWLRRRGLGVPSASASEGGTSSPAWTEMGSWVRTICGRLKQRLRLDVGREICRQYPLFCF
LLLCLSVASLLLNRYLHVLMIFWSFVAGVVTFYCSLGPDSLLPNIFFTIKYKPKQLGLQE
LFPQGHSCAVCGKVKCKRHRPSLLLENYQPWLDLKVSSKVDASLSEVLELVLENFVYPWY
RDVTDDESFVDELRITLRFFASVLVRRIHKVDIPSIITKKLLKAAMKHIEVIVKARQKVK
NTEYLQQAALEEYGPELHVALRSRRDELQYLRKLTELLFPYILPPKATDCRSLTLLIREI
LSGSVLLPSLDFLADPDTVNHLLIIFIDDSPPEKATEPASPLVPFLQKFAEPRNKKPSVL
KLELKQIREQQDLLFRFMNFLKQEGAVHVLQFCLTVEEFNDRILRPELSNDEMLSLHEEL
QKIYKTYCLDESIDKIRFDPFIVEEIQRIAEGPYIDVVKLQTMRCLFEAYEHVLSLLENV
FTPMFCHSDEYFRQLLRGAESPTRNSKFNRSTQKRGESFGISRIGSKIKGVFKSTTMEGA
VLPNYGVAEGEDDFIEEGIVVMEDDSPVEAVSTPNTPRNLAAWKISIPYVDFFEDPSSER
KEKKERIPVFCIDVERNDRRAVGHEPEHWSVYRRYLEFYVLESKLTEFHGTFPDAQLPSK
RIIGPKNYEFLKSKREEFQEYLQKLVQHPELSNSQLLADFLSPNGGETQFLDKILPDVNL
GKIIKSVPGKLMKEKGQHLEPFIMSFINSCESPKPKPSRPELTILSPTSENNKKLFNDLF
KNNANRAENTERKQNQNYFMEVMTVDGVYDYLMYVGRVVFQVPDWLHHLLMGTRILFKNT
LEMYTDYYLQCKLEQLFQEHRLVSLITLLRDAIFCENTEPRSLQDKQKGAKQTFEEMMNY
IPDLIVKCIGEETKYESIRLLFDGLQQPVLNKQLTYVLLDIVIQELFPELNKVQKEATSM
TSWM
Download sequence
Identical sequences Q8BHY8
ENSMUSP00000130116 ENSMUSP00000130116 NP_766514.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]