SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000130287 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000130287
Domain Number 1 Region: 45-144
Classification Level Classification E-value
Superfamily SH2 domain 9.02e-26
Family SH2 domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000130287   Gene: ENSMUSG00000046460   Transcript: ENSMUST00000166398
Sequence length 458
Comment pep:known chromosome:NCBIM37:9:54381953:54392827:1 gene:ENSMUSG00000046460 transcript:ENSMUST00000166398
Sequence
MEGGPEQLHLGKALEEAGGGRALAEIQELALKWFMETQAPSILQNGVLPPWFHGFITRKQ
TEQLLRDKALGSFLIRLSDRAVGYILSYRGSDRCRHFVINQLRNRRYLVSGDTLSHSTLD
ELLRHYQEVQLEPFGETLAAACPRLEENDLYDAINTGLQHTNLSLKIPATEFPSMLPDKA
TSPRLPAKPQVSFLHKKALDMSSRSVSDEVSAEVPTRVPPIPRRSPSLLDESPAGPSDVI
YTDLRKINRAQLGLGTEVWGTLRPASAGSLACSPGREPSGKLSDEDQNKPNSLGPAPSGM
KPDQGSTMPYTSLGFSLPPSSETLGSQATTWRQGFLKLSHEAQSSSEASSTDTYHLVETP
GLQQEARDRPDQRGSPYEQIPTCWHGTAKLSYPGVSPTYSQQSGPMDYGYEKISGTSKLP
EPGNTYEQIPAAKNKDTGRVHKPDKFRRLFFTDKKHKF
Download sequence
Identical sequences Q8BI17
ENSMUSP00000130287 XP_006511220.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]