SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000130339 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000130339
Domain Number 1 Region: 72-202
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.36e-47
Family Regulator of G-protein signaling, RGS 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000130339   Gene: ENSMUSG00000026358   Transcript: ENSMUST00000172388
Sequence length 209
Comment pep:known chromosome:NCBIM37:1:146091803:146096372:-1 gene:ENSMUSG00000026358 transcript:ENSMUST00000172388
Sequence
MRAAAISMPRLNKMPGMFFSASPKDSKEHSHSLLDDKKQKKRPKTFGMDVKTYLRSMIPH
LESGMKSAKSKDILSAEEVMQWSQSLEKLLANQTGQNVFGRFLKSEFSEENIEFWLACED
YKKTETDLLHNKAENIYKAFVHSDAVKQINIDFHTRESTAKKIKTPTPTSFDEAQKVIYS
LMEKDSYPRFLKSNIYLNLLNDLQANTLK
Download sequence
Identical sequences Q9JL25
ENSMUSP00000126270 ENSMUSP00000130339 ENSMUSP00000140624 NP_056626.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]