SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000130614 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000130614
Domain Number 1 Region: 39-107
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000017
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000130614
Domain Number - Region: 192-236
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00104
Family Ubiquitin-related 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000130614   Gene: ENSMUSG00000069678   Transcript: ENSMUST00000165164
Sequence length 259
Comment pep:known chromosome:NCBIM37:6:83028380:83030841:1 gene:ENSMUSG00000069678 transcript:ENSMUST00000165164
Sequence
MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTI
TECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEE
KRIREFYQSRGLDRVSQPSGEEPALSNLGLPFSSFDHSKAHYYRYDEQLSLCLERLSSGK
DKNKNVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQLWLSR
WFGKPSPLLLQYSVKEKRR
Download sequence
Identical sequences G3V730 Q8R023
ENSMUSP00000130614 ENSMUSP00000130614 10116.ENSRNOP00000011173 ENSRNOP00000011173 XP_006994397.1.50099 XP_008761304.1.100692 XP_021046757.1.100879 ENSMUSP00000130614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]