SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000130662 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000130662
Domain Number 1 Region: 98-202
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-31
Family SH2 domain 0.0000778
Further Details:      
 
Domain Number 2 Region: 43-94
Classification Level Classification E-value
Superfamily SH3-domain 0.00000113
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000130662   Gene: ENSMUSG00000022372   Transcript: ENSMUST00000167788
Sequence length 297
Comment pep:known chromosome:NCBIM37:15:66612439:66663391:-1 gene:ENSMUSG00000022372 transcript:ENSMUST00000167788
Sequence
MLCRLRVPSTAQGEKEMGNSMKSTSPPSERPLSSSEGLESDFLAVLTDYPSPDISPPIFR
RGEKLRVISDEGGWWKAISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTK
IGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVTHYSEVA
DGLCCVLTTPCLAQNIPAPTSHPSPCTSPGSPVTLRQKTFDWKRVSRLQEGSEGAENPLR
VDESLFSYGLRESIASYLSLTGDDSSSFDRKKKSLSLMYTGSKRKSSFFSAPQYFED
Download sequence
Identical sequences A0A0R4J247
NP_001025012.1.92730 ENSMUSP00000127901 ENSMUSP00000131865 ENSMUSP00000130662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]