SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131470 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131470
Domain Number 1 Region: 13-139
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.2e-47
Family Regulator of G-protein signaling, RGS 0.0000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131470   Gene: ENSMUSG00000091758   Transcript: ENSMUST00000167373
Sequence length 152
Comment pep:known chromosome:NCBIM37:1:146366820:146388442:-1 gene:ENSMUSG00000091758 transcript:ENSMUST00000167373
Sequence
VKGRCCFYRSPTTETLAWSENMDSLLANQAGLDAFRTFLKSEYSEENVEFWLACEDFKKT
ECREKIATKAKTIYSEFIVADAPKEINIDFSTRDLISRNIAEPTPKCFDEAQKLIYSLMA
KDSFPRFLKSEIYKKLVNSQQVGNHKRWLPFL
Download sequence
Identical sequences ENSMUSP00000131470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]