SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131721 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000131721
Domain Number - Region: 57-111
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0534
Family Calponin-homology domain, CH-domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131721   Gene: ENSMUSG00000091799   Transcript: ENSMUST00000165967
Sequence length 122
Comment pep:novel supercontig:NCBIM37:NT_166282:31967:34932:-1 gene:ENSMUSG00000091799 transcript:ENSMUST00000165967
Sequence
QPFSHGIFSSRMSTEQENTEMHLIECMLKHFKTQKVAISNAIRSTFPFLESLRDREFITG
KMYEDLLDSCRSLVPVDKVIYRALEELEKKFDMTVLCELFNEVNMEKYPNLNLIRRSFEC
GI
Download sequence
Identical sequences ENSMUSP00000136885 ENSMUSP00000136885 ENSMUSP00000107049 ENSMUSP00000131721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]