SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131938 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131938
Domain Number 1 Region: 120-207
Classification Level Classification E-value
Superfamily Immunoglobulin 1.1e-16
Family I set domains 0.00014
Further Details:      
 
Domain Number 2 Region: 38-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000271
Family I set domains 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131938   Gene: ENSMUSG00000059498   Transcript: ENSMUST00000164044
Sequence length 267
Comment pep:known chromosome:NCBIM37:1:172981306:172989534:-1 gene:ENSMUSG00000059498 transcript:ENSMUST00000164044
Sequence
MTLDTQMFQNAHSGSQWLLPPLTILLLFAFADRQSAALPKAVVKLDPPWIQVLKEDMVTL
MCEGTHNPGNSSTQWFHNWSSIRSQVQSSYTFKATVNDSGEYRCQMEQTRLSDPVDLGVI
SDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHS
HSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHTAFSLVMCLLFAVDTGLYFY
VRRNLQTPRDYWRKSLSIRKHQAPQDK
Download sequence
Identical sequences A0A0B4J1M6
NP_034318.2.92730 XP_006496721.1.92730 XP_006496722.1.92730 ENSMUSP00000131938 ENSMUSP00000131938 ENSMUSP00000133039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]