SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000132111 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000132111
Domain Number 1 Region: 432-773
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 4.14e-56
Family Diacylglycerol kinase-like 0.018
Further Details:      
 
Domain Number 2 Region: 5-92,154-181
Classification Level Classification E-value
Superfamily EF-hand 1.99e-37
Family EF-hand modules in multidomain proteins 0.0088
Further Details:      
 
Domain Number 3 Region: 160-245
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000446
Family Calmodulin-like 0.015
Further Details:      
 
Domain Number 4 Region: 264-319
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000142
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0046
Further Details:      
 
Domain Number 5 Region: 323-383
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000148
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000132111   Gene: ENSMUSG00000022861   Transcript: ENSMUST00000166113
Sequence length 789
Comment pep:known chromosome:NCBIM37:16:22466644:22657304:-1 gene:ENSMUSG00000022861 transcript:ENSMUST00000166113
Sequence
KMSEEQWVSLSSEEFDQLQKYSEYSSKKIKDVLAEFNEGGSLRQYDPHKPISYDVFKLFM
RAYLEVDLPQPLSTHLFLAFSQKPRQETPDHPKEGASSSEPNVSDYNSDNAAKADEACAP
DTESKTTKTQAPSKELEAAAPWEDPGALASSSDAPVVYLKDVVCYLSLMETGRPQDKLEF
MFRLYDSDENGLLDQAEMDQIVSQMLHVAQYLEWDPTELRPILKEMLQGMDYDKDGFVSL
QEWINGGMTTIPLLVLLGMDDSGSKGDGRHAWTLKHFKKPTYCNFCRAMLMGVGKQGLCC
IYCKYTVHQRCVSKTIHGCVKTNSKAKRSGEVMQHAWVEGNSSVKCDRCHKSIKCYQSVT
ARHCVWCRMTFHRKCELSTVCDGGELKDHILLPTSICPVSGDRQGGKSDGSVAAKGELVT
QYKIIPSPGTHPLLVLVNPKSGGRQGERILRKFHYLLNPEQVFNLDNGGPTPGLNFFHDT
PDFRVLACGGDGTVGWILDCIDKANFTKHPPVAVLPLGTGNDLARCLRWGGGYEGGSLTK
ILKEIEQSPLVMLDRWYLEVMPREEVENGDQVPYNIMNNYFSIGVDASIAHRFHMMREKH
PEKFNSRMKNKLWYFEFGTSETFAATCKKLHDHIELECDGVEVDLSNIFLEGIAILNIPS
MYGGTNLWGETKKNRAVIRESRKSVTDPKELKCCVQDLSDQLLEVVGLEGAMEMGQIYTG
LKSAGRRLAQCSSVTIRTNKLLPMQVDGEPWMQPQCTIKITHKNQAPMMMGPPQKSSFFS
LRRKSRSKD
Download sequence
Identical sequences Q570Z5
ENSMUSP00000132111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]