SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000132269 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000132269
Domain Number 1 Region: 5-415
Classification Level Classification E-value
Superfamily Ras GEF 3.53e-101
Family Ras GEF 0.00024
Further Details:      
 
Domain Number 2 Region: 487-547
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.89e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00086
Further Details:      
 
Domain Number 3 Region: 421-506
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000167
Family Calmodulin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000132269   Gene: ENSMUSG00000071042   Transcript: ENSMUST00000167341
Sequence length 694
Comment pep:known chromosome:NCBIM37:17:75864878:75928383:1 gene:ENSMUSG00000071042 transcript:ENSMUST00000167341
Sequence
RTMGSNGLGKAATLDELLSTCIEMFDDNGDLNDSYLPRIVLLMHRWYLSSTELAGKLLCI
YYRNASGESCDEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGHEKHISL
MDISSVPSYDWMRRVTQRKKVSKRGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQ
SYVIHGCLENNPTLERSIALFNGISKWVQLMVLSKPSAQQRAEVITKFINVAQKLLQLKN
FNTLMAVVGGLSHSSISRLKDTHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGF
KIPILGVHLKDLIAVHVIFPDWMEENKVNVVKMHQLSVTLSELVSLQNASHHLEPNMDLI
NLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWASEVVPKPDPTII
NKHIRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAY
FLRAKSQLHCKMGPGFIHNFQEMNYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCK
DLLVLACRRLARAPSLSSNPGSLPGSPALPPVQDEVFEFPGVTAGHRDLDSRAITLVTGS
SRKISVRLQRATTSQATQTEPVWSEAVWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEK
PTVQAGVDVVDRGTAFEPDQDDGQDEAKQGGEDG
Download sequence
Identical sequences ENSMUSP00000132269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]