SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000132475 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000132475
Domain Number 1 Region: 1-72
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.3e-24
Family Ubiquitin-related 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000132475   Gene: ENSMUSG00000090529   Transcript: ENSMUST00000167135
Sequence length 73
Comment pep:known chromosome:NCBIM37:12:89233832:89234325:-1 gene:ENSMUSG00000090529 transcript:ENSMUST00000167135
Sequence
MIEVVCNDRLGKKVRVKCNTDDTIGGLKKLIAAQTGTRLNKIILKKWYTIYKDHVSLGDY
EIHDGMNLELYYQ
Download sequence
Identical sequences ENSMUSP00000132475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]