SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000132694 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000132694
Domain Number 1 Region: 4-120
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-42
Family GABARAP-like 0.00000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000132694   Gene: ENSMUSG00000062081   Transcript: ENSMUST00000075768
Sequence length 125
Comment pep:known chromosome:NCBIM37:14:48698810:48699487:-1 gene:ENSMUSG00000062081 transcript:ENSMUST00000075768
Sequence
MPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNM
SELIKIIRQRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFG
TAMAV
Download sequence
Identical sequences ENSMUSP00000132694 ENSMUSP00000132694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]