SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133206 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133206
Domain Number 1 Region: 93-219
Classification Level Classification E-value
Superfamily PH domain-like 8.3e-44
Family Phosphotyrosine-binding domain (PTB) 0.000000361
Further Details:      
 
Domain Number 2 Region: 541-619
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000116
Family SH3-domain 0.00034
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000133206
Domain Number - Region: 693-747
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00408
Family SAM (sterile alpha motif) domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133206   Gene: ENSMUSG00000006154   Transcript: ENSMUST00000171445
Sequence length 777
Comment pep:novel chromosome:NCBIM37:7:4412317:4431006:1 gene:ENSMUSG00000006154 transcript:ENSMUST00000171445
Sequence
MQKRKIPPPELQRARADTGWGIISFAGGPAWLNEQAWGWKDFFRERVLRHLQVDRAPHLA
TMSTTTGPEAAPKPSAKSIYEQRKRYSTVVMADVSQYHVNHLVTFCLGEEDGVHTVEDAS
RKLAVMDSQGRVWAQEMLLRVSPSQVTLLDPVSKEELESYPLDAIVRCDAVMPRGRSRSL
LLLVCQEPERAQPDVHFFQGLLLGAELIREDIQGALQNYRSGRGERRAAALRATQEELRR
GASPAAETPPLQRRPSVRLVINTVEPSAVRGRPQVESIPETEEARKPDQARTTSSADPTS
PDLGPRGPELAGLQAERDVDILNHVFDDVESFVSRLQKSAEATRVLEHRERGRRTRRRAA
GEGLLTLRAKPPTEAEYTDVLQKIKYAFSLLARLRGNIANPSSPELLHFLFGPLQMIVNT
SGGPEFAKSVRRPHLTLEAVTLLRDNVTPGENELWTSLGDSWTCPGVELPPEEGSPYSPE
FYNGWEPPATDPQGRPWEDPVEKQLQHEKRRRQQSAPQVAVNGQQDPELETESQLEEKAR
KWVLCNYDFQARNGSELSVKHRDVLEVLDDRRKWWKVRDHQGQEGYVPYNILTPHPGPQV
HRSQSPARHLETSTPPPPPAPAPAPTQVRPQWDSCDSLNSLDPSEKEKFSQMLCVNEELQ
SRLAQGRSGPSRVTPGPRAQEPQLSPRSEASVVRAWLQTKGFSSGTVEALGVLTGAQLFS
LQKEELRAVCPEEGARVYSQVTVQRALLEDREKVSELEAVMEKQKKKVEGETKTEVI
Download sequence
Identical sequences E9Q4X5
ENSMUSP00000133206 ENSMUSP00000133102 XP_006540386.1.92730 ENSMUSP00000133206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]