SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000000641 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000000641
Domain Number 1 Region: 48-515
Classification Level Classification E-value
Superfamily Sema domain 2.22e-150
Family Sema domain 0.0000000147
Further Details:      
 
Domain Number 2 Region: 518-567
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000157
Family Plexin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000000641   Gene: ENSMUSG00000000627   Transcript: ENSMUST00000000641
Sequence length 777
Comment pep:known chromosome:NCBIM37:6:82861879:82889763:-1 gene:ENSMUSG00000000627 transcript:ENSMUST00000000641
Sequence
MLARAERPRPGPRPPPVSLFPPPSSLLLLLLAMLSAPVCGRVPRSVPRTSLPISEADSYL
TRFAAPHTYNYSALLVDPASHTLYVGARDSIFALTLPFSGEKPRRIDWMVPETHRQNCRK
KGKKEDECHNFIQILAIANASHLLTCGTFAFDPKCGVIDVSSFQQVERLESGRGKCPFEP
AQRSAAVMAGGVLYTATVKNFLGTEPIISRAVGRAEDWIRTETLSSWLNAPAFVAAMVLS
PAEWGDEDGDDEIFFFFTETSRVLDSYERIKVPRVARVCAGDLGGRKTLQQRWTTFLKAD
LLCPGPEHGRASGVLQDMTELRPQPGAGTPLFYGIFSSQWEGAAISAVCAFRPQDIRAVL
NGPFRELKHDCNRGLPVMDNEVPQPRPGECITNNMKFQQFGSSLSLPDRVLTFIRDHPLM
DRPVFPADGRPLLVTTDTAYLRVVAHRVTSLSGKEYDVLYLGTEDGHLHRAVRIGAQLSV
LEDLALFPETQPVESMKLYHDWLLVGSHTEVTQVNTSNCGRLQSCSECILAQDPVCAWSF
RLDACVAHAGEHRGMVQDIESADVSSLCPKEPGEHPVVFEVPVATVGHVVLPCSPSSAWA
SCVWHQPSGVTSLTPRRDGLEVVVTPGAMGAYACECQEGGAARVVAAYSLVWGSQRGPAN
RAHTVVGAGLVGFFLGVLAASLTLLLIGRRQQRRRQRELLARDKVGLDLGAPPSGTTSYS
QDPPSPSPEDERLPLALGKRGSGFGGFPPPFLLDSCPSPAHIRLTGAPLATCDETSI
Download sequence
Identical sequences Q9Z123
ENSMUSP00000000641 NP_035480.3.92730 ENSMUSP00000000641 10090.ENSMUSP00000000641 ENSMUSP00000000641 NYSGRC-IgSF-Q9Z123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]