SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000001480 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000001480
Domain Number 1 Region: 260-510
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.74e-91
Family Leukotriene A4 hydrolase catalytic domain 0.00048
Further Details:      
 
Domain Number 2 Region: 50-253
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 1.7e-58
Family Leukotriene A4 hydrolase N-terminal domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000001480   Gene: ENSMUSG00000001441   Transcript: ENSMUST00000001480
Sequence length 920
Comment pep:known chromosome:NCBIM37:11:97067158:97141952:-1 gene:ENSMUSG00000001441 transcript:ENSMUST00000001480
Sequence
MWLAAAVPSLARRLLLLGPPPPPLLLLLSRSSRRRRRLHSLGLAAMPEKRPFERLPAEVS
PINYSLCLKPDLLDFTFEGKLEAAAQVRQATNQIVMNCADIDIITASYAPEGDEEIHATG
FNYQNEDEKVTLSFPSTLQTGTGTLKIDFVGELNDKMKGFYRSRYTTPAGEVRYAAVTQF
EATDARRAFPCWDEPAIKATFDISLVVPKDRVALSNMNVIDRKPYPDDENLVEVKFARTP
VMSTYLVAFVVGEYDFVETRSKDGVCVRVYTPVGKAEQGKFALEVAAKTLPFYKDYFNVP
YPLPKIDLIAIADFAAGAMENWGLVTYRETALLIDPKNSCSSSRQWVALVVGHELAHQWF
GNLVTMEWWTHLWLNEGFASWIEYLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHPI
EVSVGHPSEVDEIFDAISYSKGASVIRMLHDYIGDKDFKKGMNMYLTKFQQKNAATEDLW
ESLESASGKPIAAVMNTWTKQMGFPLIYVEAEQVEDDRVLKLSQKKFCASGPYGGEDCPQ
WMVPITISTSEDPNQAKLKILMDKPEMSVVLKNVKPDQWVKLNLGTVGFYRTQYSSAMLE
SLLPGIRDLSLPPVDRLGLQNDLFSLARAGIISTVEVLKVMEAFVNEPNYTVWSDLSCNL
GILSTLLSHTDFYEEIQEFVKDVFSPIGERLGWDPKPGEGHLDALLRGLVLGKLGKAGHK
ATLEEARRRFKEHVEGKQILSADLRSPVYLTVLKHGDGATLDIMLKLHKQADMQEEKNRI
ERVLGATLSPELIQKVLTFALSEEVRPQDTVSVIGGVAGGSKHGRKAAWKFIKDNWEELH
NRYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWLK
RDADSIHQYLLQRKTSPPSV
Download sequence
Identical sequences Q11011
ENSMUSP00000001480 ENSMUSP00000001480 ENSMUSP00000001480 10090.ENSMUSP00000001480 NP_032968.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]