SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000006367 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000006367
Domain Number 1 Region: 170-366
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.21e-57
Family Prokaryotic proteases 0.000000653
Further Details:      
 
Domain Number 2 Region: 381-477
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-22
Family HtrA-like serine proteases 0.0034
Further Details:      
 
Domain Number 3 Region: 36-122
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.52e-16
Family Growth factor receptor domain 0.00087
Further Details:      
 
Domain Number 4 Region: 110-155
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000109
Family Ovomucoid domain III-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000006367   Gene: ENSMUSG00000006205   Transcript: ENSMUST00000006367
Sequence length 480
Comment pep:known chromosome:NCBIM37:7:138079717:138129174:1 gene:ENSMUSG00000006205 transcript:ENSMUST00000006367
Sequence
MQSLRTTLLSLLLLLLAAPSLALPSGTGRSAPAATVCPEHCDPTRCAPPPTDCEGGRVRD
ACGCCEVCGALEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCG
SDAKTYTNLCQLRAASRRSEKLRQPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIA
PAVVHIELYRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKNRVKVELKNGATYEA
KIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTT
QRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKI
KKFLTESHDRQAKGKAVTKKKYIGIRMMSLTSSKAKELKDRHRDFPDVLSGAYIIEVIPD
TPAEAGGLKENDVIISINGQSVVTANDVSDVIKKENTLNMVVRRGNEDIVITVIPEEIDP
Download sequence
Identical sequences Q9R118
10090.ENSMUSP00000006367 ENSMUSP00000006367 ENSMUSP00000006367 ENSMUSP00000006367 NP_062510.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]