SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000009411 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000009411
Domain Number 1 Region: 425-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-18
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 2 Region: 138-183
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000353
Family KRAB domain (Kruppel-associated box) 0.0037
Further Details:      
 
Domain Number 3 Region: 284-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000339
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 4 Region: 363-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000405
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000009411
Domain Number - Region: 47-118
Classification Level Classification E-value
Superfamily Tropomyosin 0.00157
Family Tropomyosin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000009411   Gene: ENSMUSG00000052763   Transcript: ENSMUST00000009411
Sequence length 492
Comment pep:novel chromosome:NCBIM37:6:47870475:47882638:1 gene:ENSMUSG00000052763 transcript:ENSMUST00000009411
Sequence
MAESTPTRHRRKRRATPLAPATPPSQTTEKSPYFQTTEISLWTVVAAIQAVEKKMESQAA
RLQSLEGRAGSAEKKLADFEKTAVEFSNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRN
KNFWVLRLPPGSKGETPKVSGSLENDGVCFSEQEWENLEDWQKELYRNVMESNYETLVSL
KVLGQPEEEVELGAEMVGDLVEEGTHLADRAMVKQEMLYKQEGPAGLPNMFSSAVEQQAF
FGAEQAMFWNSPGDSALLESGPGDSNPESVETSRDPAPGRNLDCPRKQKSHRQVQLGQEC
GQGLKVKRDSSPYKCPECQISFRYKQQLTAHLQSHAGRESYSATEPEESLRPRPRLKPQA
KRSKLHQCDVCHRSFSCKVSLVTHQRCHQQEGPSTSPQIQERFSPNSLVALPGHIPWRKS
RSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCPECEKSFVQKQHLLQHQKIHQRERGG
LASESARPNGLL
Download sequence
Identical sequences G3X8R7
ENSMUSP00000009411 10090.ENSMUSP00000009411 ENSMUSP00000009411 NP_663551.2.92730 ENSMUSP00000009411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]