SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020392 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020392
Domain Number 1 Region: 22-150
Classification Level Classification E-value
Superfamily Lysozyme-like 1.23e-48
Family C-type lysozyme 0.00000434
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020392   Gene: ENSMUSG00000020177   Transcript: ENSMUST00000020392
Sequence length 151
Comment pep:known chromosome:NCBIM37:10:116670817:116675759:-1 gene:ENSMUSG00000020177 transcript:ENSMUST00000020392
Sequence
MKAPLTLLTLGLLLLSITIQGKVYDRCSLARTLQSLGLAGFQGITLANWVCLAKWESNFN
TNTTRFNPEDQSTSYGIFQINSRFWCNDGKTPGSRNFCRISCKALLKSNIWSAVVCAKRI
VKDPQGIYSWAGWIKHCKNKNLKEYIRGCHL
Download sequence
Identical sequences Q8BM26
NP_084182.2.92730 10090.ENSMUSP00000020392 ENSMUSP00000020392 ENSMUSP00000125436 ENSMUSP00000020392 ENSMUSP00000020392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]