SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020535 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020535
Domain Number 1 Region: 4-124
Classification Level Classification E-value
Superfamily Globin-like 2.86e-34
Family Globins 0.0000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020535   Gene: ENSMUSG00000020295   Transcript: ENSMUST00000020535
Sequence length 145
Comment pep:known chromosome:NCBIM37:11:32200069:32200873:1 gene:ENSMUSG00000020295 transcript:ENSMUST00000020535
Sequence
MARSQDDQWLVLALWKKMGSNVGIYTTEALERTFVAFPSTKTYFPHLDLRPGSSQVKAHA
QKVADALTLATQHLDDLPASLSALSDLHAHKLCVDPANFQFFSCCLLVTLARHYPGDFSG
EKDACLLGHVSGSCDFCTGLQVMLN
Download sequence
Identical sequences Q8BYM1
NP_778165.1.92730 ENSMUSP00000020535 ENSMUSP00000020535 ENSMUSP00000020535 10090.ENSMUSP00000020535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]