SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000023741 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000023741
Domain Number 1 Region: 5430-5588
Classification Level Classification E-value
Superfamily SET domain 9.55e-49
Family Histone lysine methyltransferases 0.0065
Further Details:      
 
Domain Number 2 Region: 1376-1436
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000509
Family PHD domain 0.0039
Further Details:      
 
Domain Number 3 Region: 273-326
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000014
Family PHD domain 0.0029
Further Details:      
 
Domain Number 4 Region: 1451-1520
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000159
Family PHD domain 0.027
Further Details:      
 
Domain Number 5 Region: 1330-1384
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000012
Family PHD domain 0.017
Further Details:      
 
Domain Number 6 Region: 215-277
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000199
Family PHD domain 0.0097
Further Details:      
 
Domain Number 7 Region: 1979-2029
Classification Level Classification E-value
Superfamily HMG-box 0.00000265
Family HMG-box 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000023741   Gene: ENSMUSG00000048154   Transcript: ENSMUST00000023741
Sequence length 5588
Comment pep:known chromosome:NCBIM37:15:98662100:98701614:-1 gene:ENSMUSG00000048154 transcript:ENSMUST00000023741
Sequence
MDSQKPPAEDKDSDPAADGLAAPEKPGATEPDLPILCIGEVSVPGSGGSRPQKPPHDCSR
GPARRCALCNCGEPGLHGQRELQRFELPSDWPGFPVVPSGGNSGPCEAVLPKEDASQIGF
PEGLTPAHLGEPGGHCWAHHWCAAWSAGVWGQEGPELCGVDKAIFSGISQRCSHCARFGA
SVPCRSPGCSRLYHFPCATASGSFLSMKTLQLLCPEHSDGAAHLEEARCAVCEGPGQLCD
LLFCTSCGHHYHGACLDTALTARKRASWQCPECKVCQSCRKPGNDSKMLVCETCDKGYHT
FCLKPPMEDLPAHSWKCKTCRLCRACGAGSAELNPNSEWFENYSLCHRCHKAQGSQPVTS
VAEQHPAVCSRLSPPEPGEIPIDAPDALYVACQGQPKGGHVTSMQPKELAPLQCEAKPLG
RAGTQLEAQLEAPLHEEMPLLPPPEESPLSPPPEESPTSPPPEASRLSPPTEESPLSPPP
ESSPFSPLEGCPPSPALDTPLSPPPEASPLSPPFEESPLSPPPEELPSSPPPEASRLSPP
PEESPMSPPPEESPMSPPPEASRLFPPFEESPLSPPPEDSPLSPPPEASRLSPPPEDSPM
SPPPEDSPMSPPPEVSRFLPLPVLSHLSPLPEVSRLSPPPEESPLSPPPEDSPASPPPEA
SRLSPPPEDSPASPPPEASRLSRPREDSPASPPPEDSLVSLPMEESPLSPLPEELRLCPQ
PEEPYLSPQPEEPRLCPQPEELPLSPQSEEPCLSPVLVEPGPSSQPEEPHLSPVPQEPHL
SPQPEEPHLSPQPQQLHLSPHSEEPCLSPMPEEPCLSPQPEELNGPPQPAEPPEEPSQSS
APKELSLFSPSGEPPLPPMLGEPALSEPGEPPLSPLPEELPLSLSGEPVLSPQLMPPDPL
PPPLSPIIPAAAPPALSPLGELEYPFGAKGDSDPESPLAAPILETPISPPPEANCTDPEP
VPPMILPPSPGSPLGPASPILMERLPPPCSPLLPHSLPPPTPPPSHCSPPALPLSVPSPL
SPVQKAVDVSDEAELHEMETDKGPEPECPALEPRATSPLPSPLGDLSCPAPSPAPALDDF
SGLGEDTAPLDGTGQMSGSLAGELKGSPVLLDPEELTPVTPMEVYGPECKQAGQGSPCEE
QEEPGAPMAPMPPTLIKSDIVNEISNLSQGDASASFPGSEPLLGSPDPEGGGSLSMELGV
STDVSPARDEGSLRLCTDSLPETDDSLLCDTGTATSGGKAEGDKGRRRSSPARSRIKQGR
SSSFPGRRRPRGGAAHGGRGRGRARLKSTTSSVETLVADIDSSPSKEEEEEDDDTMQNTV
VLFSNTDKFVLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWRC
VECIVCEVCGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGAAS
PGFHCEWQNSYTHCGPCASLVTCPVCHAPYVEEDLLIQCRHCERWMHAGCESLFTEDEVE
QAADEGFDCVSCQPYVVKPVVPVAPPELVPVKVKEPEPQFFRFEGVWLTETGMAVLRNLT
MSPLHKRRQRRGRLGLPGEAGLEGSEPSDALGPDDKKDGDLDTDDLLKGEGGVEQMECEI
KLEGPASPDVELGKEETEESKKRKRKPYRPGIGGFMVRQRKSHTRVKRGPAAQAEVLSGD
GQPDEVMPADLPAEGSVEQSLAEGDEKKKQQRRARKKSKLEDMFPAYLQAAFFGKDLLDL
SRKALFAVGVGRPGFGLGASKPRADGGSDRKELMTAMHKGDDGPDVADEESHGPEGTADL
PGLEDGGVKASPVPSDPEKPGTPGEGVLSSDLDRIPTEELPKMESKDLQQLFKDVLGSER
EQHLGCGTPGLEGGRTSLQRPFLQGGLALGSLPSSSPMDSYPGLCQSPFLDSRERGGFFS
PEPGEPDSPWTGSGGTTPSTPTTPTTEGEGDGLSYNQRSLQRWEKDEELGQLSTISPVLY
ANINFPNLKQDYPDWSSRCKQIMKLWRKVPAADKAPYLQKAKDNRAAHRISKVQKQAESQ
ISKQAKMGDIARKTDRPALHLRIPSQPGALGSPPPAAAPTIFLGSPTTPAGLSTSADGFL
KPPAGTVPGPDSPGELFLKLPPQVPAQVPSQDPFGLAPAYAPEPRFSAAPPTYPPYPSPT
GAPAQPPMLGTTTRPGTGQPGEFHTTPPGTPRHQPSTPDPFLKPRCPSLDNLAVPESPGV
AGGKASEPLLSPPPFGESRKSLEVKKEELGASSPGYGPPNLGCVDSPSAGPHLGGLELKA
PDVFKAPLTPRASQVEPQSPGLGLRAQEPPPAQALAPSPPSHPDVFRSGPYPDPYAQPPL
TPRPQPPPPESCCAPPPRSLPSDPFSRVPASPQSQSSSQSPLTPRPLSAEAFCPSPVTPR
FQSPDPYSRPPSRPQSRDPFAPLHKPPRPQPPEVAFKAGPLAHTPLGAGGFPAALPSGPA
GELHAKVPSGQPTNFARSPGTGTFVGTPSPMRFTFPQGVGEPSLKPPVPQPGLPSPHGIN
SHFGPGPTLGKPQSTNYAVATGNFHPSGSPLGPNSGPTGEGYGLSPLRPASVLPPPAPDG
SLPYLTHGASQRVGITSPVEKREDPGATMSSSSLATPELSSAQDAGISSLSQTELEKQRQ
RQRLRELLIRQQIQRNTLRQEKETAAAAAGAVGPPGNWGAEPSSPAFEQLSRGQTPFTGS
QDRSSIVGLPASKLGGPTLGPGAFSSDDRLARPLPPATPSSMDMNSRQLVGGSQAFYQRT
PYPGSLPLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLWQQQQQQQQQQQQQAAAAAAAT
SMRLAMSARFPSTPGPELGRQALGSPLAGIPTRLPGPAEPVPGPAGPAQFIELRHNVQKG
LGPGVSPFPGQGPPQRPRFYPVSEELHRLAPEGLRGLAVPGLPSQKPSALPAPELNNSLH
QTPHAKGPALASGLELVSRPPSNTELSRPPLALEAGKLPCEDPELDDDFDAHKALEDDEE
LAHLGLGVDVAKGDDELGTLENLETNDPHLDDLLNGDEFDLLAYTDPELDTGDKKDIFNE
HLRLVESANEKAEREALLRGVEPVSLGPEERPPPAPDNSEPRLTSVLPEVKPKVEEGGRH
PSPCQFTINTPKVEPAPPATSLSLGLKPGQTVMGTRDTRGGVGTGSFPSSGHTAEKGPFG
ATGGTPAHLLNPSSLSGPAASSLLEKFELESGALTLPSGHAAAGDELDKMESSLVASELP
LLIEDLLEHEKKELQKKQQLSAQTVLPAQQQQQQQQQQQQQQQQHTLLPTPGPAQALPLP
HEPGPPQQLALGIGSTRQPGLGQSMVPIQPPAHALQQRLAPSVAMVSNQGHMLSGQQAGQ
TGLVPQQSSQPVLAQKPMSAMPASMCMKPQQLAMQQQQLANSFFPDTDLDKFAAEDIIDP
IAKAKMVALKGIKKVMAQGSIGVAPGMNRQQVSLLAQRLSGGSGSDLQNHVAPGSGQERN
AGDPAQPRPNPPTFAQGVINEADQRQYEEWLFHTQQLLQMQLKVLEEQIGVHRKSRKALC
AKQRTAKKAGREFPEADAEKLKLVTEQQSKIQKQLDQVRKQQKEHTNLMAEYRNKQQQQQ
QQQQQQQQQQHSAVLAVSPSQNPRVLTKLPGQLLPAHGLQPPQAPPGGQAGGLRLPPGGM
VLPGQSGGPFLNTTLAQQQQQQHSGVAGSLTGPPGSFFPGNLALRSLGPDSRLLQERQLQ
LQQQRMQLAQKLQQQQQQQQQQQQQQHLLGQVAIQQQQGPGVQNQALGPKPQGLLPPSNH
QGLLVQQLSPQQSQGSQGLLGPAQVTVLQQQQQQQQHSGALGPQGPHRQVLMTQSRVLSS
PQLAQQGHSLMGHRLLTAQQQQQQQQQQQQQQQQQQQQQQQQQGSMTGLSQLQQGMMSHG
GQPKMSAQALGSLQQQQQQLQQQQMLQQQQLQQQQQQLQQQQQQQQLQQQQQQQLQLQQQ
QQQQQQHLQHQQQQQQQLQQQQQLQQQQQQQLHLQQQLHQQQQLQLQQQQMGLLNQNRTL
LSPQQQQQQQQQQQQQQQQQQQQQQQQQQVTLGPGLPVKPLQHFSSSGALGPTLLLTGKE
QNNAETALPSEVTEGPSTHQGGPPAVGTAPEPMSVEPGEVKPSISGDSQLLLVQSQAQSQ
ATSVQLQPPLRLPGQPQPQVNLLHTAGGGSHGQQLGSGSSSESPAVPHLLAQPSVSLGEQ
PGPMAQNLLGSQQPLGLDRPIQNNTGSQPPKSGPAPQSGQGPPGAGVMPTVGQLRAQLQG
VLAKNPQLRHLSPQQQQQLQALLMQRQLQQSQAVRQTPPFQEPGTQPSPLQGLLGCQPQP
GGFSVSQTGPLQELGAGSRPQGPPRLPVPQGALSTGPVLGPAHPTPPPSSPQEPKRPSQL
PSPSAQLTPTHPGTPKPQGPALELPPGRVSPAAAQLADTFFGKGLGPWDPSDNLTEAQKP
EQSSLVPGHLDQVNGQVVHEPSQLSIKQEPREEPCALGAQTVKREANGEPAGAPGTSNHL
LLAGSRSEAGHLLLQKLLRAKNVQLGAGRGPEGLRAEINGHIDSKLSGLEQKLQGTSSNK
EDAATRKPLPAKPKRVQKTSDRLPSSRKKLRKEDGVRANEALLKQLKQELSQLPLTEPTI
TANFSLFAPFGSGCLVSGQSQLRGAFGSGALHTGPDYYSQLLTKNNLSNPPTPPSSLPPT
PPPSVQQKMVNGVTPSDELGERPKDTASAQDSEGALRDAAEVKSLDLLAALPTPPHNQTE
DVRMESDEDSDSPDSIVPASSPESILGEEAPRFPQLGSGRWEQDNRALSPVIPIIPRTGI
PVFPDTKPYGVLDLEVPGKLPATAWEKGKGSEVSVMLTVSAAAAKNLNGVMVAVAELLSM
KIPNSYEVLFPDGPARAGLEPKKGEAEGPGGKEKGLSGKGPDTGPDWLKQFDAVLPGYTL
KSQLDILSLLKQESPAPEPSIQHSYTYNVSNLDVRQLSAPPPEEPSPPPSPLAPSPASPP
AEPMVELQAERPAEPPIPSPLPLASSPESARPKPRARPPEESEDSRPPRLKKWKGVRWKR
LRLLLTIQKGSGHQEDEREVAEFMEQFGTALRPSKVPRDNRRCCFCHEEGDGATDGPARL
LNLDLDLWVHLNCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSCNRMRC
PNVYHFACAIRAKCMFFKDKTMLCPVHKIKGPCEQELSSFAVFRRVYIERDEVKQIASII
QRGERLHMFRVGGLVFHAIGQLLPHQMADFHSATALYPVGYEATRIYWSLRTNNRRCCYR
CSISENNGRPEFVIKVIEQGLEDLVFTDASPQAVWNRIIEPVAAMRKEADMLRLFPEYLK
GEELFGLTVHAVLRIAESLPGVESCQNYLFRYGRHPLMELPLMINPTGCARSEPKILTHY
KRPHTLNSTSMSKAYQSTFTGETNTPYSKQFVHSKSSQYRRLRTEWKNNVYLARSRIQGL
GLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGP
ARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQHKIPCHCGA
WNCRKWMN
Download sequence
Identical sequences Q6PDK2
ENSMUSP00000023741 ENSMUSP00000135941 ENSMUSP00000023741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]