SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000024659 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000024659
Domain Number 1 Region: 957-1171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-103
Family Thrombospondin C-terminal domain 0.00000000547
Further Details:      
 
Domain Number 2 Region: 25-226
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.63e-38
Family Laminin G-like module 0.0000121
Further Details:      
 
Domain Number 3 Region: 834-956
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.75e-36
Family TSP type-3 repeat 0.000000541
Further Details:      
 
Domain Number 4 Region: 765-836
Classification Level Classification E-value
Superfamily TSP type-3 repeat 3.92e-17
Family TSP type-3 repeat 0.00023
Further Details:      
 
Domain Number 5 Region: 493-544
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.49e-16
Family TSP-1 type 1 repeat 0.000092
Further Details:      
 
Domain Number 6 Region: 436-491
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000955
Family TSP-1 type 1 repeat 0.0000996
Further Details:      
 
Domain Number 7 Region: 692-777
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000497
Family TSP type-3 repeat 0.00011
Further Details:      
 
Domain Number 8 Region: 318-375
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000743
Family VWC domain 0.004
Further Details:      
 
Domain Number 9 Region: 381-425
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000419
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 10 Region: 549-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000223
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000024659   Gene: ENSMUSG00000023885   Transcript: ENSMUST00000024659
Sequence length 1172
Comment pep:known chromosome:NCBIM37:17:14805653:14831269:-1 gene:ENSMUSG00000023885 transcript:ENSMUST00000024659
Sequence
MLWALALLALGIGPRASAGDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
DYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGP
GDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFY
EQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGAEVNTISEH
TETLHLSPHITTDLVVQGVEKAQEVCTHSCEELSNMMNELSGLHVMVNQLSKNLERVSSD
NQFLLELIGGPLKTRNMSACVQEGRIFAENETWVVDSCTTCTCKKFKTVCHQITCSPATC
ANPSFVEGECCPSCSHSADSDEGWSPWAEWTECSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRTCSLGKCDTRIRQNGGWSHWSPWSSCSVTCGVGNVTRIRLCNSPVPQMGGKNCKGSG
RETKPCQRDPCPIDGRWSPWSPWSACTVTCAGGIRERSRVCNSPEPQYGGKDCVGDVTEH
QMCNKRSCPIDGCLSNPCFPGAKCNSFPDGSWSCGSCPVGFLGNGTHCEDLDECAVVTDI
CFSTNKAPRCVNTNPGFHCLPCPPRYKGNQPFGVGLEDARTEKQVCEPENPCKDKTHSCH
KNAECIYLGHFSDPMYKCECQIGYAGDGLICGEDSDLDGWPNNNLVCATNATYHCIKDNC
PKLPNSGQEDFDKDGIGDACDEDDDNDGVSDEKDNCQLLFNPRQLDYDKDEVGDRCDNCP
YVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
MHNPDQIDQDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNSNQADHDNDGKGDACDSDD
DNDGVPDDRDNCRLVFNPDQEDSDGDGRGDICKDDFDNDNVPDIDDVCPENNAITETDFR
NFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDR
DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDKPSRAYGYSGVSLKVVNSTTGTGEHLRN
ALWHTGNTEGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGYMRVLVHEGKQVMADSGPI
YDQTYAGGRLGLFVFSQEMVYFSDLKYECREA
Download sequence
Identical sequences ENSMUSP00000024659 10090.ENSMUSP00000024659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]