SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000026994 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000026994
Domain Number 1 Region: 808-888
Classification Level Classification E-value
Superfamily DEATH domain 4.83e-20
Family DEATH domain, DD 0.00016
Further Details:      
 
Domain Number 2 Region: 241-291
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000876
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 3 Region: 151-242
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000236
Family I set domains 0.025
Further Details:      
 
Domain Number 4 Region: 295-349
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000107
Family TSP-1 type 1 repeat 0.00059
Further Details:      
 
Domain Number 5 Region: 44-146
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000101
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000026994   Gene: ENSMUSG00000025876   Transcript: ENSMUST00000026994
Sequence length 898
Comment pep:known chromosome:NCBIM37:13:55050772:55107379:1 gene:ENSMUSG00000025876 transcript:ENSMUST00000026994
Sequence
MAVRPGLWPALLGIVLTAWLRGSGAQQSATVANPVPGANPDLLPHFLVEPEDVYIVKNKP
VLLVCKAVPATQIFFKCNGEWVRQVDHVIERSTDGSSGLPTMEVRINVSRQQVEKVFGLE
EYWCQCVAWSSSGTTKSQKAYIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGIPPAE
VEWLRNEDLVDPSLDPNVYITREHSLVVRQARLADTANYTCVAKNIVARRRSASAAVIVY
VNGGWSTWTEWSVCSASCGRGWQKRSRSCTNPAPLNGGAFCEGQNVQKTACATLCPVDGS
WSPWSKWSACGLDCTHWRSRECSDPAPRNGGEECRGADLDTRNCTSDLCLHTSSGPEDVA
LYIGLVAVAVCLILLLLVLVLIYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLL
TIQPDLSTTTTTYQGSLCPRQDGPSPKFQLSNGHLLSPLGSGRHTLHHSSPTSEAEDFVS
RLSTQNYFRSLPRGTSNMAYGTFNFLGGRLMIPNTGISLLIPPDAIPRGKIYEIYLTLHK
PEDVRLPLAGCQTLLSPIVSCGPPGVLLTRPVILAMDHCGEPSPDSWSLRLKKQSCEGSW
EDVLHLGEESPSHLYYCQLEAGACYVFTEQLGRFALVGEALSVAATKRLRLLLFAPVACT
SLEYNIRVYCLHDTHDALKEVVQLEKQLGGQLIQEPRVLHFKDSYHNLRLSIHDVPSSLW
KSKLLVSYQEIPFYHIWNGTQQYLHCTFTLERVNASTSDLACKVWVWQVEGDGQSFNINF
NITKDTRFAEMLALESEGGVPALVGPSAFKIPFLIRQKIITSLDPPCSRGADWRTLAQKL
HLDSHLSFFASKPSPTAMILNLWEARHFPNGNLGQLAAAVAGLGQPDAGLFTVSEAEC
Download sequence
Identical sequences Q8K1S4
ENSMUSP00000026994 10090.ENSMUSP00000026994 ENSMUSP00000026994 NYSGRC-IgSF-Q8K1S4 NP_694771.1.92730 ENSMUSP00000026994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]