SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000027952 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000027952
Domain Number 1 Region: 39-508
Classification Level Classification E-value
Superfamily Sema domain 3.79e-128
Family Sema domain 0.0000259
Further Details:      
 
Domain Number 2 Region: 1350-1479,1675-1863
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-51
Family p120GAP domain-like 0.037
Further Details:      
 
Domain Number 3 Region: 951-1040
Classification Level Classification E-value
Superfamily E set domains 4.9e-19
Family Other IPT/TIG domains 0.069
Further Details:      
 
Domain Number 4 Region: 1040-1142
Classification Level Classification E-value
Superfamily E set domains 9.67e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.052
Further Details:      
 
Domain Number 5 Region: 855-952
Classification Level Classification E-value
Superfamily E set domains 0.00000000000257
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 6 Region: 511-562
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000419
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 7 Region: 1139-1220
Classification Level Classification E-value
Superfamily E set domains 0.0000000476
Family E-set domains of sugar-utilizing enzymes 0.061
Further Details:      
 
Domain Number 8 Region: 807-841
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000406
Family Plexin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000027952   Gene: ENSMUSG00000026640   Transcript: ENSMUST00000027952
Sequence length 1894
Comment pep:known chromosome:NCBIM37:1:196446023:196643063:1 gene:ENSMUSG00000026640 transcript:ENSMUST00000027952
Sequence
MEQRRFYLRAMQADNLSVVLLSVAWLLLARGTTGMPQYSTFHSENRDWTFNHLTVHRRTG
AVYVGAINRVYKLTGNLTIQVAHKTGPEEDNKACYPPLIVQPCSEVLTLTNNVNKLLIID
YSENRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNKTGTMYGVIVRSEGEDG
KLFIGTAVDGKQDYFPTLSSRKLPRDPESSAMLDYELHSDFVSSLIKIPSDTLALVSHFD
IFYIYGFASGGFVYFLTVQPETPDGMAINSAGDLFYTSRIVRLCKDDPKFHSYVSLPFGC
TRAGVEYRLLQAAYLAKPGEALAQAFNISSDEDVLFAIFSKGQKQYHHPPDDSALCAFPI
RAINLQIKERLQSCYHGEGNLELNWLLGKDVQCTKAPVPIDDNFCGLDINQPLGGSTPVE
GLTLYTTSRDRLTSVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVFKDGS
PILRDMAFSINQLYLYVMSERQVTRVPVESCEQYTTCGECLSSGDPHCGWCALHNMCSRR
DKCQRAWEANRFAASISQCMSLEVHPNSISVSDHSRLLSLVVNDAPNLSEGIACAFGNLT
EVEGQVSGSQVICISPGPKDVPVIPLDQDWFGLELQLRSKETGKIFVSTEFKFYNCSAHQ
LCLSCVNSAFRCHWCKYRNLCTHDPTTCSFQEGRINVSEDCPQLVPTEEILIPVGEVKPI
TLKARNLPQPQSGQRGYECVLSIQGAVHRVPALRFNSSSVQCQNSSYQYDGMDISNLAVD
FAVVWNGNFIIDNPQDLKVHLYKCAAQRESCGLCLKADHKFECGWCSGERRCTLHQHCPS
TSSPWLDWSSHNVKCSNPQITEILTVSGPPEGGTRVTIHGVNLGLDFSEIAHHVQVAGVP
CTPIPGEYIIAEQIVCEMGHAVIGTTSGPVRLCIGECKPEFMTKSHQQYTFVNPSVLSLS
PIRGPESGGTMVTITGHYLGAGSSVAVYLGNQTCEFYGRSMNEIVCVSPPSSNGLGPVPV
SVSVDRARVDSSLQFEYIDDPRVQRIEPEWSITSGHTPLTITGFNLDVIQEPRVRVKFNG
KESVNVCTVVNTTTLTCLAPSLTSDYRPGLDTVERPDEFGFLFNNVQSLLIYNDTKFIYY
PNPTFELLSPTGILDQKPGSPIILKGKNLCPPASGGAKLNYTVMIGETPCTVTVSETQLL
CEPPNLTGQHKVMVHVGGMVFSPGSVSVISDSLLTLPAIISIAAGGSLLLIIVIIVLIAY
KRKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELTSDLDRSGIPYLDYRTY
AMRVLFPGIEDHPVLRELEVQGNGQQHVEKALKLFAQLINNKVFLLTFIRTLELQRSFSM
RDRGNVASLIMTGLQGRLEYATDVLKQLLSDLIDKNLENKNHPKLLLRRTESVAEKMLTN
WFAFLLHKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTL
ILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNVPYSQRPRAVDMDLEWRQGRI
ARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQTSSYNIPASASISRTSISR
YDSSFRYTGSPDSLRSRVPMITPDLESGVKVWHLVKNHDHGDQKEGDRGSKMVSEIYLTR
LLATKGTLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQADRHSIHDTDVRHTWKS
NCLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLY
AKDIPSYKNWVERYYADIAKLPAISDQDMNAYLAEQSRLHATEFNMLSALNEIYSYVSKY
SEELIGALEQDEQARRQRLAYKVEHLINAMSIES
Download sequence
Identical sequences P70207
NP_032908.2.92730 ENSMUSP00000027952 ENSMUSP00000027952 ENSMUSP00000027952 10090.ENSMUSP00000027952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]