SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000027984 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000027984
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily SH2 domain 3.23e-28
Family SH2 domain 0.000000868
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000027984   Gene: ENSMUSG00000026673   Transcript: ENSMUST00000027984
Sequence length 132
Comment pep:known chromosome:NCBIM37:1:172207507:172216900:1 gene:ENSMUSG00000026673 transcript:ENSMUST00000027984
Sequence
MDLPYYHGCLTKRECEALLLKGGVDGNFLIRDSESVPGALCLCVSFKKLVYSYRIFREKH
GYYRIETNAHTPRTIFPNLQELVSKYGKPGQGLVVHLSNPIMRNNLCQRGRRMELELNVY
ENTDKEYVDVLP
Download sequence
Identical sequences Q149T1
NP_036139.3.92730 ENSMUSP00000027984 10090.ENSMUSP00000027984 ENSMUSP00000137069 ENSMUSP00000137069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]