SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000029676 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029676
Domain Number 1 Region: 213-413
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.87e-56
Family Reprolysin-like 0.000055
Further Details:      
 
Domain Number 2 Region: 431-505
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 3.14e-20
Family Blood coagulation inhibitor (disintegrin) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000029676   Gene: ENSMUSG00000028041   Transcript: ENSMUST00000029676
Sequence length 864
Comment pep:known chromosome:NCBIM37:3:89143562:89153918:-1 gene:ENSMUSG00000028041 transcript:ENSMUST00000029676
Sequence
MRLALLWALGLLGAGSPRPSPPLPNIGGTEEEQQASPERTLSGSMESRVVQDSPPMSLAD
VLQTGLPEALRISLELDSESHVLELLQNRDLIPGRPTLVWYQPDGTRMVSEGYSLENCCY
RGRVQGHPSSWVSLCACSGIRGLIVLSPERGYTLELGPGDLQRPVISRIQDHLLLGHTCA
PSWHASVPTRAGPDLLLEQHHAHRLKRDVVTETKIVELVIVADNSEVRKYPDFQQLLNRT
LEAALLLDTFFQPLNVRVALVGLEAWTQHNLIEMSSNPAVLLDNFLRWRRTDLLPRLPHD
SAQLVTVTSFSGPMVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHD
SPGHSCPCPGPAPAKSCIMEASTDFLPGLNFSNCSRQALEKALLEGMGSCLFERQPSLAP
MSSLCGNMFVDPGEQCDCGFPDECTDPCCDHFTCQLRPGAQCASDGPCCQNCKLHPAGWL
CRPPTDDCDLPEFCPGDSSQCPSDIRLGDGEPCASGEAVCMHGRCASYARQCQSLWGPGA
QPAAPLCLQTANTRGNAFGSCGRSPGGSYMPCAPRDVMCGQLQCQWGRSQPLLGSVQDRL
SEVLEANGTQLNCSWVDLDLGNDVAQPLLALPGTACGPGLVCIGHRCQPVDLLGAQECRR
KCHGHGVCDSSGHCRCEEGWAPPDCMTQLKATSSLTTGLLLSLLLLLVLVLLGASYWHRA
RLHQRLCQLKGSSCQYRAPQSCPPERPGPPQRAQQMTGTKQASVVSFPVPPSRPLPPNPV
PKKLQAALADRSNPPTRPLPADPVVRRPKSQGPTKPPPPRKPLPANPQGQHPPGDLPGPG
DGSLPLVVPSRPAPPPPAASSLYL
Download sequence
Identical sequences O88839
NP_001032811.2.92730 ENSMUSP00000029676 ENSMUSP00000139147 ENSMUSP00000029676 ENSMUSP00000029676 10090.ENSMUSP00000029676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]