SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000030464 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000030464
Domain Number 1 Region: 349-456
Classification Level Classification E-value
Superfamily SH2 domain 1.16e-31
Family SH2 domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 54-162
Classification Level Classification E-value
Superfamily SH2 domain 4.04e-31
Family SH2 domain 0.00000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000030464   Gene: ENSMUSG00000028698   Transcript: ENSMUST00000030464
Sequence length 461
Comment pep:known chromosome:NCBIM37:4:115894266:115975661:1 gene:ENSMUSG00000028698 transcript:ENSMUST00000030464
Sequence
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTPAVTNGMKDSFISL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSEPLTFTSVVELINHYHHESLAQYNPKLDVKLTYPVSRFQQDQLVKEDNIDAVGKN
LQEFHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKDY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKLRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHRGVRQRRLNAWLGIKNEDSDESYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPTLCR
Download sequence
Identical sequences Q3UXE9 Q64143
10090.ENSMUSP00000030464 ENSMUSP00000030464 ENSMUSP00000102099 NP_853616.1.92730 XP_017175528.1.92730 XP_017175529.1.92730 ENSMUSP00000030464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]