SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000032754 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000032754
Domain Number 1 Region: 37-511
Classification Level Classification E-value
Superfamily Sema domain 8.5e-162
Family Sema domain 0.00000000233
Further Details:      
 
Domain Number 2 Region: 512-563
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000082
Family Plexin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000032754   Gene: ENSMUSG00000030539   Transcript: ENSMUST00000032754
Sequence length 823
Comment pep:known chromosome:NCBIM37:7:87331727:87371280:1 gene:ENSMUSG00000030539 transcript:ENSMUST00000032754
Sequence
MGRASRSAVLRRALLLLLLLLLLRTTTTRALGPRISVPLGSEERLIRKFEAENISNYTAL
LLSQDGKTLYVGAREALFALNSNLSFLPGGEYQELLWSADADRKQQCSFKGKDPKRDCQN
YIKILLPLNSSHLLTCGTAAFSPLCAYIHIASFTLAQDEAGNVILEDGKGRCPFDPNFKS
TALVVDGELYTGTVSSFQGNDPAISRSQSSRPTKTESSLNWLQDPAFVASAYVPESLGSP
IGDDDKIYFFFSETGQEFEFFENTIVSRVARVCKGDEGGERVLQQRWTSFLKAQLLCSRP
DDGFPFNVLQDVFTLNPNPQDWRKTLFYGVFTSQWHRGTTEGSAICVFTMNDVQKAFDGL
YKKVNRETQQWYTETHQVPTPRPGACITNSARERKINSSLQLPDRVLNFLKDHFLMDGQV
RSRLLLLQPRARYQRVAVHRVPGLHSTYDVLFLGTGDGRLHKAVTLSSRVHIIEELQIFP
QGQPVQNLLLDSHGGLLYASSHSGVVQVPVANCSLYPTCGDCLLARDPYCAWTGSACRLA
SLYQPDLASRPWTQDIEGASVKELCKNSSYKARFLVPGKPCKQVQIQPNTVNTLACPLLS
NLATRLWVHNGAPVNASASCRVLPTGDLLLVGSQQGLGVFQCWSIEEGFQQLVASYCPEV
MEEGVMDQKNQRDGTPVIINTSRVSAPAGGRASWGADKSYWNEFLVMCTLFVFAMVLLFL
FFLYRHRDGMKLFLKQGECASVHPKTRPIVLPPETRPLNGVGPPSTPLDHRGYQALSDSS
PGPRVFTESEKRPLSIQDSFVEVSPVCPRPRVRLGSEIRDSVV
Download sequence
Identical sequences Q62179
ENSMUSP00000032754 NYSGRC-IgSF-Q62179 10090.ENSMUSP00000032754 NP_038687.2.92730 XP_011249132.1.92730 ENSMUSP00000032754 ENSMUSP00000032754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]