SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034458 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034458
Domain Number 1 Region: 115-435
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.28e-62
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000016
Further Details:      
 
Domain Number 2 Region: 430-564
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.24e-31
Family Ricin B-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034458   Gene: ENSMUSG00000089704   Transcript: ENSMUST00000034458
Sequence length 570
Comment pep:known chromosome:NCBIM37:8:126755291:126869622:1 gene:ENSMUSG00000089704 transcript:ENSMUST00000034458
Sequence
MRRRSRMLLCFALLWVLGIAYYMYSGGGSALAAGGGGAGRKGDWNDIDSIKKKDLHHSRG
DEKAQGVETLPPGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLHMDRGIPDT
RHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKRSPPHLIKEIILVDDYSNDP
EDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNERWLEPLLERV
AEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPI
KTPMIAGGLFVMDKLYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVF
RKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKHFYYAAVPSARNVPYGNIQSRLELRKKL
GCKPFKWYLDNVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGIYECHNAGGNQE
WALTKEKSVKHMDLCLTVVDRSPGSLIRLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLD
SRTAKSGGLSVEVCGPALSQQWKFSLNLQQ
Download sequence
Identical sequences Q6PB93
ENSMUSP00000034458 ENSMUSP00000034458 ENSMUSP00000034458 NP_644678.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]