SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034524 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034524
Domain Number 1 Region: 41-216
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.21e-44
Family DnaQ-like 3'-5' exonuclease 0.00000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034524   Gene: ENSMUSG00000032026   Transcript: ENSMUST00000034524
Sequence length 237
Comment pep:known chromosome:NCBIM37:9:48276619:48288716:-1 gene:ENSMUSG00000032026 transcript:ENSMUST00000034524
Sequence
MLGVSLGARLLRGVGGRRGQFGARGVSEGSAAMAAGESMAQRMVWVDLEMTGLDIEKDQI
IEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTVTLQQA
EYEFLSFVRQQTPPGLCPLAGNSVHADKKFLDKHMPQFMKHLHYRIIDVSTVKELCRRWY
PEDYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKTDEKKRKIIENGETEKPVS
Download sequence
Identical sequences Q9D8S4
NP_077195.2.92730 XP_021062408.1.100879 10090.ENSMUSP00000034524 ENSMUSP00000034524 ENSMUSP00000034524 ENSMUSP00000034524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]