SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000036270 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000036270
Domain Number 1 Region: 185-391
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-50
Family DBL homology domain (DH-domain) 0.000000305
Further Details:      
 
Domain Number 2 Region: 2-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-39
Family Calponin-homology domain, CH-domain 0.0045
Further Details:      
 
Domain Number 3 Region: 378-540
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-32
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 4 Region: 667-768,817-843
Classification Level Classification E-value
Superfamily SH2 domain 1.4e-27
Family SH2 domain 0.0005
Further Details:      
 
Domain Number 5 Region: 769-845
Classification Level Classification E-value
Superfamily SH3-domain 8.2e-18
Family SH3-domain 0.00078
Further Details:      
 
Domain Number 6 Region: 590-697
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000217
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000036270   Gene: ENSMUSG00000033721   Transcript: ENSMUST00000046864
Sequence length 847
Comment pep:known chromosome:NCBIM37:3:109143571:109488616:1 gene:ENSMUSG00000033721 transcript:ENSMUST00000046864
Sequence
MEPWKQCAQWLIHSKVLPPNHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRPHSINLKEI
NLRPQMSQFLCLKNIRTFLAACCDTFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEESINDEDIYKGLPDLIDETRVEDEEDLYDCVYGEDEGGEVYEDLMKAE
EAQQPKSQENDIRSCCLAEIRQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPD
LVKVHRSLMQEIHDSIVNKDDQNLYQVFINYKERLVIYGQYCSGVESAISNLDYISKTKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTHDPMEKANLKLALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCRVCQMLLRGTFYQ
GYLCFKCGAKAHKECLGRVDNCGRVNSVEQGPFKPPEKRTNGLRRASRQVDPGLPKMQVI
RNYTGTPAPGLHEGPPLHIQAGDTVELLRGDAHSVFWQGRNLASGEVGFFPSDAVKPSPC
VPKPVDYSCQPWYAGPMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIK
ILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEQPAGQRGNRT
GNSLLSPKVLGIAIARYDFCARDMRELSLLKGDMVKIYTKMSANGWWRGEVNGRVGWFPS
TYVEEDE
Download sequence
Identical sequences Q9R0C8
ENSMUSP00000036270 10090.ENSMUSP00000036270 ENSMUSP00000036270 NP_065251.2.92730 ENSMUSP00000036270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]