SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000039900 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000039900
Domain Number 1 Region: 744-971
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.42e-59
Family DBL homology domain (DH-domain) 0.00000000108
Further Details:      
 
Domain Number 2 Region: 350-526
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.13e-54
Family Regulator of G-protein signaling, RGS 0.0000000445
Further Details:      
 
Domain Number 3 Region: 975-1109
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-41
Family Pleckstrin-homology domain (PH domain) 0.00000036
Further Details:      
 
Domain Number 4 Region: 25-121
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-21
Family PDZ domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000039900
Domain Number - Region: 149-160
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00288
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000039900   Gene: ENSMUSG00000041977   Transcript: ENSMUST00000039476
Sequence length 1552
Comment pep:known chromosome:NCBIM37:3:87421497:87541955:1 gene:ENSMUSG00000041977 transcript:ENSMUST00000039476
Sequence
MSIRLPHSIDRLSSLSSLGDSTPERTSPSHHRQPSDTSETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMRAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSIGVSGLQQNPSLSGGPRVNPMIPPPPPPPPLPPPQHITGPKPLQDPEVQKHATQ
ILRNMLRQEEKELQRICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGLVDVLPLC
GETSQRTCEGRLSVDSQEADSGLDSGTERFPSISESLVNRNSVLSDPGLDSPQTSPVILA
RVGQHHRRQGSDAAVHPLNHQGIDQSPKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSH
PAYLVVFLRYIFSQADPGPLLFYLCSEVYQQTNPKDSRNLGKDIWNIFLEKNAPLRVKIP
EMLQAEIDLRLRNSEDPRSALYEAQEAVMPEIQEQINDYRSKRTLGLGSLYGENDLLDLD
GDPLRERQMAEKQLAALGDILSKYEEDRSAPMDFAVNTYMSHTGIRLRESRPSSTAEKTQ
SAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILRYIGKPKSSSQSIKPGNVRNIIQ
HFENSHQYDVPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREEMKRSRKAENV
PRSRSDVDMDAAAEATRLHQSASSSASSLSTRSLENPTPPFTPKMGRRSIESPNLGFCTD
VILPHLLEDDLGQLSDLEPEPEVQNWQHTVGKDVVANLTQREIDRQEVINELFVTEASHL
RTLRVLDLIFYQRMKKENLMPREELSRLFPNLPELIEIHNSWCEAMKKLREEGPIIRDIS
DLMLARFDGPAREELQQVAAQFCSYQSVALELIRTKQRKESRFQLFMQEAESHPQCRRLQ
LRDLIISEMQRLTKYPLLLENIIKHTAGGTSEYEKLCRARDQCREILKFVNEAVKQTENR
HRLEGYQKRLDATALERASNPLAAEFKSLDLTTRKMIHEGPLTWRISKDKTLDLQVLLLE
DLVVLLQRQEEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIRSVATDKRAFFIICTSE
LGPPQIYELVALTSSDKNIWMELLEEAVQNATKHPGDAPVLNHPSPPGSQEPAYQGSTSS
RVEVNDSEVYPTEREPKKPSEGPGPEQRGQDKQLLAQEGPEQEEDAEELRALPCPPPSLD
GENRGIRTRDPVLLALTGPLLMEGLADAALEDVENLRHLILWSLLPGHTVKTQAAGEPED
DLTPTPSVVSITSHPWDPGSPGQAPAISDNTQFPRPEGSQPEGEDVALCSLAHLPPRTRN
SGIWDSPELDRNPAEEASSSEPAGSYKVVRKVSLLPGGGVGAAKVAGSNVTPALPESGQS
ESELSEVEGGAQATGNCFYVSMPAEPLDSSTEPPGTPPSLSQCHSLPAWPTEPPQHRGVT
GGQRSSLVLRDMGVIFHTIEQLTVKLHRLKDMELAHRELLNSLGGESSGGTTPVGSFHTE
AARWTDYSLSPPAKEALTSDPQNNQEQGSYPEEGSDTPLEDSATDTASSPGP
Download sequence
Identical sequences Q68FM7
NP_001003912.1.92730 10090.ENSMUSP00000039900 ENSMUSP00000039900 ENSMUSP00000039900 ENSMUSP00000039900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]