SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000039955 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000039955
Domain Number 1 Region: 233-319
Classification Level Classification E-value
Superfamily SH2 domain 5.95e-45
Family SH2 domain 0.0000147
Further Details:      
 
Domain Number 2 Region: 10-146
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 4.97e-42
Family N-terminal domain of cbl (N-cbl) 0.00036
Further Details:      
 
Domain Number 3 Region: 148-232
Classification Level Classification E-value
Superfamily EF-hand 8.04e-40
Family EF-hand modules in multidomain proteins 0.00015
Further Details:      
 
Domain Number 4 Region: 325-401
Classification Level Classification E-value
Superfamily RING/U-box 2.91e-36
Family RING finger domain, C3HC4 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000039955   Gene: ENSMUSG00000040525   Transcript: ENSMUST00000043822
Sequence length 496
Comment pep:known chromosome:NCBIM37:7:20365067:20382158:-1 gene:ENSMUSG00000040525 transcript:ENSMUST00000043822
Sequence
MAAAAAPRGWQRGEPRALSRAVKLLQRLEEQCRDPRMVTGPPSLRDLLPRTAQLLGEVAK
ARREAREDPEGPGGADDFLAIYLANLEVKGRQVAELLPPRGKKDVNQDVFREGSRFRRQL
AKLALIFSHMHAELSALFPAGKYCGHLYQLTKGSAHIFWRQNCGVRCVLPWAEFQSLLCA
CHPVEPGPTMQALRSTLDLTCNGHVSVFEFDVFTRLFQPWPTLLRNWQLLAVNHPGYMAF
LTYDEVQTRLQAYRDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPLNKPLLQVLLKG
QKDGIFLFPDGKKHNPDLTELCRVEPYQRIQVSEEQLLLYQAMNSTFQLCKICAERDKDV
RIEPCGHLLCSCCLAAWQDSDSQTCPFCRCEIKGREAVSICQAQERPTEVRTAADGSRDN
CHQEAAEQKLGPVIPSAPSLLPEDQFPQGPQDKGWLTLAPLALPRLRPPLPLPKMASVLW
EVTSRPRAREEATESS
Download sequence
Identical sequences Q80XL1
ENSMUSP00000039955 ENSMUSP00000039955 ENSMUSP00000039955 NP_075713.3.92730 10090.ENSMUSP00000039955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]