SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000041796 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000041796
Domain Number 1 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.34e-27
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.55e-27
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 47-93
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.07e-20
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 5 Region: 378-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 164-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000856
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000041796   Gene: ENSMUSG00000037007   Transcript: ENSMUST00000049393
Sequence length 439
Comment pep:known chromosome:NCBIM37:5:138580930:138596972:-1 gene:ENSMUSG00000037007 transcript:ENSMUST00000049393
Sequence
METQADHASQAPLPLLESALSSSKVPSFPDKDSLGDKMLAAALLKAKSQELVTFEDVAVY
FIWREWKRLEPAQRDLYRDVMLENYGNVFSLDGDSKTGNDRVISEGMGSCEMILGRFQKD
VSQGLKFEEAYEQEVSLQRQLGNSSVGRLNRKIQEFHQVRVEEKLTHIGERNKKYSEFGN
SFTVNSKLISHQRLQMGDKPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECSECGKAFSQ
SAHLIQHQRIHTGEKPYECKDCGKTFSCSSALILHQRIHTGEKPYECNECGKTFSWSSTL
THHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQ
RIHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHT
GEKPLTVMGVKQKLSQSLC
Download sequence
Identical sequences Q8C689
NP_062721.2.92730 ENSMUSP00000041796 ENSMUSP00000041796 10090.ENSMUSP00000041796 ENSMUSP00000041796 ENSMUSP00000127561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]