SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000043545 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000043545
Domain Number 1 Region: 536-749
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.55e-52
Family DBL homology domain (DH-domain) 0.00031
Further Details:      
 
Domain Number 2 Region: 227-371
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-42
Family Third domain of FERM 0.00047
Further Details:      
 
Domain Number 3 Region: 872-1026
Classification Level Classification E-value
Superfamily PH domain-like 2.28e-33
Family Pleckstrin-homology domain (PH domain) 0.0012
Further Details:      
 
Domain Number 4 Region: 734-856
Classification Level Classification E-value
Superfamily PH domain-like 4.37e-30
Family Pleckstrin-homology domain (PH domain) 0.0079
Further Details:      
 
Domain Number 5 Region: 126-229
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-27
Family Second domain of FERM 0.0001
Further Details:      
 
Domain Number 6 Region: 41-126
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.47e-21
Family First domain of FERM 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000043545   Gene: ENSMUSG00000034066   Transcript: ENSMUST00000041983
Sequence length 1065
Comment pep:known chromosome:NCBIM37:1:95425145:95518549:1 gene:ENSMUSG00000034066 transcript:ENSMUST00000041983
Sequence
MGEIEGTYRALPTSGTRLGGQTAIGVSTLEPEQSLSPRMQEKHMRIRVKLLDSTVELFDI
EPKCDGQVLLTQVWKHLNLIECDYFGLEFKNVQSYWIWLEPMKPIIRQVRKPKNAVLRLA
VKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCTANTAALLISHLLQSEIGDYDETLD
REHLKANEYLPNQEKSLEKILDFHQRHTGQTPAESDFQVLEIARKLEMYGIRFHMASDRE
GTKINLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLL
GSRDECKNFWKICVEYHTFFRLSDQPKPKAKAVFFSRGSSFRYSGRTQKQLVDYVKDGGM
KRIPYERRHSKTRTSLHALTVDLPKQSVSFTDGLRTSASLSSANVSFYPPPSSSLSPPGL
PNLKDSSSSLVDPQAPVIKSTAAERSSGPSSSDGPSTQSAHLPGPPVLRPGPGFSMDSPQ
PSPSSLKSHLSLCPELQAALSTAEQGASPVLSPVLSGAGTARMDNQEEQKHKHMPEDEAY
FIAKEILATERTYLKDLEVITVWFRSVLIKEEAMPAALMALLFSNIDPVYEFHRGFLHEV
EQRLALWEGPSSAHLKGDHQRIGDILLRNMRQLKEFTSYFQRHDEVLTELEKATKHCKKL
EAVYKEFELQKVCYLPLNTFLLKPVQRLVHYRLLLSRLCAHYSPGHRDYADCHEALKAIT
EVTTELQQSLTRLENLQKLTELQRDLVGVENLIAPGREFIREGCLHKLTKKGLQQRMFFL
FSDMLLYTSKSVTGASHFRIRGFLPLRGMLVEESENEWSVPHCFTIYAAQKTIVVAASTR
LEKEKWMQDLNAAIQAAKTIGDSPPVLLGGPVYTRTPRSSDEVSLEESEDGRGNRGSLEG
NSQHRANTTMHVCWYRNTSVSRADHSAAVENQLSGYLLRKFKNSNGWQKLWVVFTNFCLF
FYKTHQDDYPLASLPLLGYSVSLPREADSIHKDYVFKLQFKSHVYFFRAESKYTFERWMD
VIKRASSSPGRPPSFTQDCSHHSPGLEAEIREKEACPSPCLDKNL
Download sequence
Identical sequences Q91VS8
10090.ENSMUSP00000108530 ENSMUSP00000112725 NP_663494.2.92730 ENSMUSP00000043545 ENSMUSP00000043545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]