SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000063066 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000063066
Domain Number 1 Region: 41-510
Classification Level Classification E-value
Superfamily Sema domain 2.75e-130
Family Sema domain 0.0000194
Further Details:      
 
Domain Number 2 Region: 1354-1480,1675-1864
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.14e-52
Family p120GAP domain-like 0.031
Further Details:      
 
Domain Number 3 Region: 1043-1147
Classification Level Classification E-value
Superfamily E set domains 4.3e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.067
Further Details:      
 
Domain Number 4 Region: 956-1044
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000255
Family Other IPT/TIG domains 0.027
Further Details:      
 
Domain Number 5 Region: 859-957
Classification Level Classification E-value
Superfamily E set domains 0.000000000000033
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 6 Region: 513-565
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000102
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 7 Region: 1144-1234
Classification Level Classification E-value
Superfamily E set domains 0.000000686
Family E-set domains of sugar-utilizing enzymes 0.036
Further Details:      
 
Domain Number 8 Region: 812-844
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000196
Family Plexin repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000063066   Gene: ENSMUSG00000030084   Transcript: ENSMUST00000049845
Sequence length 1894
Comment pep:known chromosome:NCBIM37:6:89269009:89307711:-1 gene:ENSMUSG00000030084 transcript:ENSMUST00000049845
Sequence
MPLPPLSSRTLLLLLLLLLRGVWIAISSPPAGLGPQPAFRTFVASDWGLTHLVVHEQTGE
VYVGAVNRIYKLSGNLTLLRAHVTGPVEDNEKCYPPPSVQSCPHGLGSTDNVNKLLLLDY
AANRLLACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVREAGSMAGVLIAGPPGQGQ
AKLFVGTPIDGKSEYFPTLSSRRLMANEEDADMFGFVYQDEFVSSQLKIPSDTLSKFPAF
DIYYVYSFRSEQFVYYLTLQLDTQLTSPDAAGEHFFTSKIVRLCVNDPKFYSYVEFPIGC
EQAGVEYRLVQDAYLSRPGQALAKQLGLAEDEEVLFTVFAQGQKNRVKPPKESALCLFTL
RAIKEKIKERIQSCYRGEGKLSLPWLLNKELGCINSPLQIDDDFCGQDFNQPLGGTVTIE
GTPLFVDKEDGLTAVAAYDYQGRTVVFAGTRSGRIRKILVDLANPSGRPALAYESVVAQE
GNPILRDLVLSPNRQYLYAMTEKQVTQVPVESCVQYTSCELCLGSRDPHCGWCVLHSICS
RQDACERAEEPQRFASDLLQCVQLTVQPRNVSVTMSQVPLVLQAWNVPDLSAGVNCSFED
FTETESILEDGRIHCHSPSAREVAPITQGQGDQRVVKLYLKSKETGKKFASVDFVFYNCS
VHQSCLACVNGSFPCHWCKYRHVCTNNAADCAFLEGRVNMSEDCPQILPSTHIYVPVGVV
KPITLAARNLPQPQSGQRGYECLFHIPGSPARVTALRFNSSSLQCQNSSYSYEGNDVSDL
PVNLSVVWNGNFVIDNPQNIQAHLYKCPALRQSCGLCLKADPRFECGWCVAERRCSLRHH
CPADSPASWMHAHHGSSRCTDPKILKLSPETGPRQGGTRLTITGENLGLRFEDVRLGVHV
GKVLCSPVESEYISAEQIVCEIGDASTLRAHDALVEVCVRDCSLHYRALSPKRFTFVTPT
FYRVSPSRGPLSGGTWIGIEGSHLNAGSDVAVSIGGRPCSFSWRNSREIRCLTPPGHTPG
SAPIVININRAQLSNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIR
AKYGGIERENSCMVYNDTTMVCRAPSIDNPKRSPPELGERPDEIGFIMDNVRTLLVLNSS
SFLYYPDPVLEPLSPTGLLELKPSSPLILKGRNLLPPAPGNSRLNYTVLIGSTPCILTVS
ETQLLCEAPNLTGQHKVTVRAGGFEFSPGMLQVYSDSLLTLPAIVGIGGGGGLLLLVIVA
VLIAYKRKSRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTSDLDGAGIPFL
DYRTYAMRVLFPGIEDHPVLKEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFS
MRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLT
NWFTFLLYKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKT
LTLNCVNPEHENAPEVPVKGLNCDTVTQVKEKLLDAVYKGVPYSQRPKAGDMDLEWRQGR
MARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQTSAYNISNSSTFTKSLSR
YESMLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHLDQREGDRGSKMVSEIYLTR
LLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQIHDSDVRHTWKS
NCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSPSNKLLY
AKDIPNYKSWVERYYADIAKMPAISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSYIAKY
KDEILVALEKDEQARRQRLRSKLEQVVDTMALSS
Download sequence
Identical sequences P70206
NP_032907.1.92730 ENSMUSP00000063066 ENSMUSP00000063066 10090.ENSMUSP00000063066 ENSMUSP00000063066 ENSMUSP00000131840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]