SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000063562 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000063562
Domain Number 1 Region: 610-636,667-906
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.06e-61
Family Nuclear receptor ligand-binding domain 0.00000000175
Further Details:      
 
Domain Number 2 Region: 557-635
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-23
Family Nuclear receptor 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000063562   Gene: ENSMUSG00000031870   Transcript: ENSMUST00000070463
Sequence length 926
Comment pep:known chromosome:NCBIM37:9:8900468:8965425:1 gene:ENSMUSG00000031870 transcript:ENSMUST00000070463
Sequence
MTELQAKDPQVLHTSGASPSPPHIGSPLLARLDSGPFQGSQHSDVSSVVSPIPISLDGLL
FPRSCRGPELPDGKTGDQQSLSDVEGAFSGVEATHREGGRNSRAPEKDSRLLDSVLDSLL
TPSGTEQSHASPPACEAITSWCLFGPELPEDPRSVPATKGLLSPLMSRPEIKAGDSSGTG
AGQKVLPKGLSPPRQLLLPTSGSAHWPGAGVKPSPQPAAGEVEEDSGLETEGSAAPLLKS
KPRALEGTGSGGGVAANAASAAPGGVTLVPKEDSRFSAPRVSLEQDSPIAPGRSPLATTV
VDFIHVPILPLNHALLAARTRQLLEGDSYDGGATAQGPFAPPRGSPSAPSPPVPCGDFPD
CTYPLEGDPKEDVFPLYGDFQTPGLKIKEEEEGADAAVRSPRPYLSAGASSSTFPDFPLA
PAPQRAPSSRPGEAAVAGGPSSAAVSPASSSGSALECILYKAEGAPPTQGSFAPLPCKPP
AAGSCLLPRDSLPAAPATAAAPAIYQPLGLNGLPQLGYQAAVLKDSLPQVYPPYLNYLRP
DSEASQSPQYGFDSLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRN
DCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVMRTLDGVALPQSVGLPNESQ
ALGQRITFSPNQEIQLVPPLINLLMSIEPDVVYAGHDNTKPDTSSSLLTSLNQLGERQLL
SVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQ
RMKELSFYSLCLTMWQIPQEFVKLQVTHEEFLCMKVLLLLNTIPLEGLRSQSQFEEMRSS
YIRELIKAIGLRQKGVVPSSQRFYQLTKLLDSLHDLVKQLHLYCLNTFIQSRTLAVEFPE
MMSEVIAAQLPKILAGMVKPLLFHKK
Download sequence
Identical sequences Q00175
ENSMUSP00000063562 ENSMUSP00000140124 NP_032855.2.92730 ENSMUSP00000063562 ENSMUSP00000063562 10090.ENSMUSP00000063562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]