SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000069549 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000069549
Domain Number 1 Region: 73-414
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-87
Family Protein kinases, catalytic subunit 0.00000221
Further Details:      
 
Domain Number 2 Region: 948-1013
Classification Level Classification E-value
Superfamily G protein-binding domain 2.88e-22
Family RhoA-binding domain 0.0000604
Further Details:      
 
Domain Number 3 Region: 1117-1207,1289-1320
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000631
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 1226-1275
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000112
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Domain Number 5 Region: 426-528
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000942
Family Myosin rod fragments 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000069549
Domain Number - Region: 709-777
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0301
Family Myosin rod fragments 0.006
Further Details:      
 
Domain Number - Region: 626-706
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0798
Family Myosin rod fragments 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000069549   Gene: ENSMUSG00000024290   Transcript: ENSMUST00000067947
Sequence length 1354
Comment pep:known chromosome:NCBIM37:18:10064399:10181790:-1 gene:ENSMUSG00000024290 transcript:ENSMUST00000067947
Sequence
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYLPSANASENRSSSNV
DKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNLKLDKIMKELDEEGNQRRNLESA
VSQIEKEKMLLQHRINEYQRKVEQENEKRRNIENEVSTLKDQLEDLRKASQTSQLANEKL
TQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQAD
KDYYQLQAVLEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLERVEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSIQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVETEKQCSMLDVDLKQSQQKLEHLTENKERMEDEVKNLALQLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLRKIQELQSEKETLSTQLDLAETKAE
SEQLARGILEEQYFELTQESKKAASRNRQEITDKDHTVSRLEETNSVLTKDIEMLRKENE
ELNERMRTAEEEYKLKKEEEINNLKAAFEKNISTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECTHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSSPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDIEVEPVQQGEKTNFQNHKGHEFIPTLYHFPANCEACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLISPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKVVKNTSGKTS
Download sequence
Identical sequences P70335
ENSMUSP00000069549 ENSMUSP00000069549 NP_033097.1.92730 ENSMUSP00000069549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]