SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000071619 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000071619
Domain Number 1 Region: 541-655
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000369
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 
Domain Number 2 Region: 85-267
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000155
Family Clathrin adaptor core protein 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000071619   Gene: ENSMUSG00000017670   Transcript: ENSMUST00000071699
Sequence length 798
Comment pep:known chromosome:NCBIM37:2:165116617:165142403:-1 gene:ENSMUSG00000017670 transcript:ENSMUST00000071699
Sequence
MPPPSDIVKVAIEWPGANAQLLEIDQKRPLASIIKEVCDGWSLPNPEYYTLRYADGPQLY
VTEQTRNDIKNGTILQLAVSPSRAARQLMERTQSSSMETRLDAMKELAKLSADVTFATEF
INMDGIIVLTRLVESGTKLLSHYSEMLAFTLTAFLELMDHGIVSWDMVSVTFIKQIAGYV
SQPMVDVSILQRSLAILESMVLNSQSLYQKIAEEITVGQLISHLQVSNQEIQTYAIALIN
ALFLKAPEDKRQDMANAFAQKHLRSIILNHVIRGNRPIKTEMAHQLYVLQVLTFNLLEER
MMTKMDPNDQAQRDIIFELRRIAFDAESDPSNVPGSGTEKRKAMYTKDYKMLGFTNHINP
ALDFTQTPPGMLALDNMLYLAKVHQDTYIRIVLENSSREDKHECPFGRSAIELTKMLCEI
LQVGELPNEGRNDYHPMFFTHDRAFEELFGICIQLLNKTWKEMRATAEDFNKVMQVVREQ
ITRALPSKPNSLDQFKSKLRSLSYSEILRLRQSERMSQDDFQSPPIVELREKIQPEILEL
IKQQRLNRLCEGSSFRKIGNRRRQERFWHCRLALNHKVLHYGDLDDNPQGEVTFESLQEK
IPVADIKAIVTGKDCPHMKEKSALKQNKEVLELAFSILYDPDETLNFIAPNKYEVSSVPH
CLEHQCPHCEEVSVPHCLEHQCSHCEEVWPAQRYPHKPGSQNGSLSLWTFYHWAGLPTSH
RGLSSSAFRGLGLELCATTPNLSLCALEQLAWHREGFPLCNLAVTFPRRVESQLPGANLV
RLWSQMDLPLLTRDSQFT
Download sequence
Identical sequences ENSMUSP00000071619 10090.ENSMUSP00000071619 ENSMUSP00000071619 ENSMUSP00000099377 ENSMUSP00000099377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]