SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000072334 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000072334
Domain Number 1 Region: 562-687
Classification Level Classification E-value
Superfamily PH domain-like 1.62e-19
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Domain Number 2 Region: 99-274
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000284
Family HspBP1 domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000072334   Gene: ENSMUSG00000041112   Transcript: ENSMUST00000072519
Sequence length 741
Comment pep:known chromosome:NCBIM37:13:20182488:20698397:1 gene:ENSMUSG00000041112 transcript:ENSMUST00000072519
Sequence
DLRFYLLCTSSSHTMPPPSDIVKVAIEWPGAYPKLMEIDQKKPLSAIIKEVCDGWSLANH
EYFALQHADSSNFYITEKNRNEIKNGTILRLTTSPAQNAQQLHERIQSSSMDAKLEALKD
LASLSRDVTFAQEFINLDGISLLTQMVESGTERYQKLQKIMKPCFGDMLSFTLTAFVELM
DHGIVSWDTFSVAFIKKIASFVNKSAIDISILQRSLAILESMVLNSHDLYQKVAQEITIG
QLIPHLQGTDQEIQTYTIAVINALFLKAPDERRQEMANILAQKQLRYIILTHVIRAQRAI
NNEMAHQLYVLQVLTFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAESEPNNSSGSME
KRKSMYTRDYKKLGFINHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSRE
DKHECPFGRSSIELTKMLCEILKVGELPSETCNDFHPMFFTHDRSFEEFFCICIQLLNKT
WKEMRATSEDFNKVMQVVKEQVMRALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQE
DFQSRPILELKEKIQPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVL
HYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSILY
DSNCQLNFIAPDKHEYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQI
PDAPPPIPKEPSNYDFVYDCN
Download sequence
Identical sequences ENSMUSP00000072334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]