SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000074758 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000074758
Domain Number 1 Region: 860-944
Classification Level Classification E-value
Superfamily DEATH domain 6.67e-24
Family DEATH domain, DD 0.0000456
Further Details:      
 
Domain Number 2 Region: 168-260
Classification Level Classification E-value
Superfamily Immunoglobulin 2.77e-16
Family I set domains 0.024
Further Details:      
 
Domain Number 3 Region: 259-310
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000419
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 313-367
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000235
Family TSP-1 type 1 repeat 0.00076
Further Details:      
 
Domain Number 5 Region: 62-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000172
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000074758   Gene: ENSMUSG00000059921   Transcript: ENSMUST00000075282
Sequence length 950
Comment pep:known chromosome:NCBIM37:3:141128538:141492433:1 gene:ENSMUSG00000059921 transcript:ENSMUST00000075282
Sequence
MRKGLRATAARCGLGLGYLLQMLVLPALALLSASGTGSAAQDDEFFHELPETFPSDPPEP
LPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHVVDERVDETSGLIVR
EVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSL
EQEVLLQCRPPEGIPVAEVEWLKNEDIIDPAEDRNFYITIDHNLIIKQARLSDTANYTCV
AKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGYQKRTRTCTNPAPLNGGAFCE
GQSVQKIACTTLCPVDGRWTSWSKWSTCGTECTHWRRRECTAPAPKNGGKDCDGLVLQSK
NCTDGLCMQGFIYPISTEHRPQNEYGFSSAPDSDDVALYVGIVIAVTVCLAITVVVALFV
YRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSD
KIPMTNSPILDPLPNLKIKVYNSSGAVTPQDDLAEFSSKLSPQMTQSLLENEALNLKNQS
LARQTDPSCTAFGTFNSLGGHLIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPM
EDSQTLLTPVVSCGPPGALLTRPVILTLHHCADPSTEDWKIQLKNQAVQGQWEDVVVVGE
ENFTTPCYIQLDAEACHILTENLSTYALVGQSTTKAAAKRLKLAIFGPLCCSSLEYSIRV
YCLDDTQDALKEVLQLERQMGGQLLEEPKALHFKGSIHNLRLSIHDIAHSLWKSKLLAKY
QEIPFYHIWSGSQRNLHCTFTLERLSLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTG
IDLPLLDPASTITTVTGPSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNY
FATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQY
Download sequence
Identical sequences Q3UQ08
ENSMUSP00000074758 ENSMUSP00000118212 10090.ENSMUSP00000074758 NYSGRC-IgSF-O08747 ENSMUSP00000074758 ENSMUSP00000101843 NP_001280490.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]